(data stored in ACNUC7421 zone)

EMBL: CP001509.FLC

CP001509.FLC         Location/Qualifiers
FT   CDS_pept        complement(617916..618299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flc"
FT                   /locus_tag="ECD_00594"
FT                   /product="fluoride efflux channel, dual topology membrane
FT                   protein"
FT                   /note="similar to b0624"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00594"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42472"
FT                   /protein_id="ACT42472.1"
FT                   /translation="MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLAANLIGA
FT                   FIIGMGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVF
FT                   VNLLGSFAMTALAFWLFSASTAH"
     gtgttacaac ttcttttagc agtttttatt ggcggtggta cgggaagcgt ggcgagatgg        60
     ctgttaagta tgcgatttaa cccgctgcat caggcgattc cgttggggac gctggcagca       120
     aacctgattg gggcattcat cataggaatg ggattcgcat ggttcagcag gatgacgaac       180
     attgatccag tgtggaaagt attaatcacc accggatttt gtggcggtct aacaaccttc       240
     tcaacatttt cggcagaagt ggtgtttttg ttacaagagg gtcgctttgg ctgggcatta       300
     ctgaacgttt tcgtcaacct tctggggtct tttgccatga cagcactggc tttctggctg       360
     ttttcggcct caaccgcaca ctaa                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page