(data stored in ACNUC7421 zone)

EMBL: CP001509.FRMR

CP001509.FRMR        Location/Qualifiers
FT   CDS_pept        complement(348942..349217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frmR"
FT                   /locus_tag="ECD_00311"
FT                   /product="regulator protein that represses frmRAB operon"
FT                   /note="similar to b0357"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00311"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42210"
FT                   /protein_id="ACT42210.1"
FT                   /translation="MPSTPEEKKKVLTRVRRIRGQIDALERSLEGDAECRAILQQIAAV
FT                   RGAANGLMAEVLESHIRETFDRNDCYSREVSQSVDDTIELVRAYLK"
     atgcccagta ctccggaaga gaagaaaaag gtccttactc gagttcgtcg tattcgaggg        60
     cagattgatg ctctggaacg gtcgctggag ggtgatgccg aatgccgtgc catactccaa       120
     cagatcgctg ccgttcgggg cgcggctaat gggctgatgg cagaagtgct tgaaagccat       180
     atccgggaaa cgtttgaccg aaatgactgc tacagccgcg aagtcagcca atccgttgac       240
     gacactattg aactggttcg agcctatctt aaatag                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page