(data stored in ACNUC7421 zone)

EMBL: CP001509.FRSA

CP001509.FRSA        Location/Qualifiers
FT   CDS_pept        261021..262265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frsA"
FT                   /locus_tag="ECD_00234"
FT                   /product="fermentation-respiration switch protein; PTS
FT                   Enzyme IIA(Glc)-binding protein; pNP-butyrate esterase
FT                   activity"
FT                   /note="similar to b0239"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00234"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42133"
FT                   /protein_id="ACT42133.1"
FT                   /translation="MTQANLSETLFKPRFKHPETSTLVRRFNHGAQPPVQSALDGKTIP
FT                   HWYRMINRLMWIWRGIDPREILDVQARIVMSDAERTDDDLYDTVIGYRGGNWIYEWATQ
FT                   AMVWQQKACAEEDPQLSGRHWLHAATLYNIAAYPHLKGDDLAEQAQALSNRAYEEAAQR
FT                   LPGTMRQMEFTVPGGAPITGFLHMPKGDGPFPTVLMCGGLDAMQTDYYSLYERYFAPRG
FT                   IAMLTIDMPSVGFSSKWKLTQDSSLLHQHVLKALPNVPWVDHTRVAAFGFRFGANVAVR
FT                   LAYLESPRLKAVACLGPVVHTLLSDFKCQQQVPEMYLDVLASRLGMHDASDEALRVELN
FT                   RYSLKVQGLLGRRCPTPMLSGYWKNDPFSPEEDSRLITSSSADGKLLEIPFNPVYRNFD
FT                   KGLQEITDWIEKRLC"
     atgacacagg caaacctgag cgaaaccctg ttcaaacccc gctttaaaca tcctgaaacc        60
     tcgacgctag tccgccgctt taatcacggc gcacaaccgc ctgtgcagtc ggctcttgat       120
     ggtaaaacca tccctcactg gtatcgcatg attaaccgtc tgatgtggat ctggcgcggt       180
     attgacccac gtgaaatcct cgacgtccag gcacgtattg tgatgagcga tgctgaacgt       240
     accgacgatg atttatacga tactgtgatt ggctaccgtg gtggcaactg gatttatgag       300
     tgggccaccc aggcgatggt gtggcaacaa aaagcctgtg cggaagaaga tccgcaactc       360
     agtggtcgac actggctgca tgcggctacg ttgtacaaca ttgccgccta tcctcatctg       420
     aaaggagatg acctggccga gcaagcgcag gctttatcaa accgcgccta tgaagaggcc       480
     gcccagcgtc tgccgggcac gatgcggcag atggagttta ccgtacccgg cggtgcgccc       540
     atcaccggct ttttgcatat gccgaaaggc gatggcccgt tcccgacagt attaatgtgt       600
     ggtggtctgg atgcgatgca gacggactat tacagcctgt atgaacgtta ttttgcgccg       660
     cgcggcattg cgatgctgac tattgatatg ccatcggtgg gcttttcttc aaaatggaag       720
     ctcacccagg actccagcct gttgcatcag cacgtcttaa aggcgctgcc taacgtaccg       780
     tgggtggatc acactcgcgt cgcggccttt ggtttccgtt tcggcgctaa cgttgccgtg       840
     cgtctggcat atcttgaatc gccgcgtctg aaagcggttg cctgtcttgg tccggtagtt       900
     cataccctgt tgagtgattt taagtgccag caacaggtgc cggaaatgta tcttgacgtt       960
     ctggccagtc gtttggggat gcatgatgct tccgatgaag cgttgcgcgt ggagctgaat      1020
     cgctattcat taaaagtgca aggattgctg ggacgtcgct gcccaacgcc aatgttatca      1080
     ggctactgga agaacgatcc gttcagcccg gaagaggact cacgcttaat cacctcatca      1140
     tctgctgacg gtaaattatt agagatccca tttaacccgg tgtatcggaa ttttgacaaa      1200
     ggtcttcagg aaatcacaga ctggatcgaa aaacgtttgt gttaa                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page