(data stored in ACNUC7421 zone)

EMBL: CP001509.FTSA

CP001509.FTSA        Location/Qualifiers
FT   CDS_pept        106787..108049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="ECD_00095"
FT                   /product="ATP-binding cell division FtsK recruitment
FT                   protein"
FT                   /note="similar to b0094"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00095"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41996"
FT                   /protein_id="ACT41996.1"
FT                   /translation="MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRG
FT                   MDKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEV
FT                   TQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITC
FT                   HNDMAKNIVKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYT
FT                   GGALRHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVG
FT                   GRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQ
FT                   IEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEK
FT                   RVTASVGSWIKRLNSWLRKEF"
     atgatcaagg cgacggacag aaaactggta gtaggactgg agattggtac cgcgaaggtt        60
     gccgctttag taggggaagt tctgcccgac ggtatggtca atatcattgg cgtgggcagc       120
     tgcccgtcgc gtggtatgga taaaggcggg gtgaacgacc tcgaatccgt ggtcaagtgc       180
     gtacagcgcg ccattgacca ggcagaattg atggcagatt gtcagatctc ttcggtatat       240
     ctggcgcttt ctggtaagca tatcagctgc cagaatgaaa ttggtatggt gcctatttct       300
     gaagaagaag taacgcaaga agatgtggaa aacgtcgtcc ataccgcgaa atcggtgcgt       360
     gtgcgcgatg agcatcgtgt gctgcatgtg atcccgcaag agtatgcgat tgactatcag       420
     gaagggatca agaatccggt aggactttcg ggcgtgcgga tgcaggcaaa agtgcacctg       480
     atcacatgtc acaacgatat ggcgaaaaac atcgtcaaag cggttgaacg ttgtgggctg       540
     aaagttgacc aactgatatt tgccggactg gcatcaagtt attcggtatt gacggaagat       600
     gaacgtgaac tgggtgtctg cgtcgtcgat atcggtggtg gtacaatgga tatcgccgtt       660
     tataccggtg gggcattgcg ccacactaag gtaattcctt atgctggcaa tgtcgtgacc       720
     agtgatatcg cttacgcctt tggcacgccg ccaagcgacg ccgaagcgat taaagttcgc       780
     cacggttgtg cgctgggttc catcgttgga aaagatgaga gcgtggaagt gccgagcgta       840
     ggtggtcgtc cgccacggag tctgcaacgt cagacactgg cagaggtgat cgagccgcgc       900
     tataccgagc tgctcaacct ggtcaacgaa gagatattgc agttgcagga aaagcttcgc       960
     caacaagggg ttaaacatca cctggcggca ggcattgtat taaccggtgg cgcagcgcag      1020
     atcgaaggtc ttgcagcctg tgctcagcgc gtgtttcata cgcaagtgcg tatcggcgcg      1080
     ccgctgaaca ttaccggttt aacggattat gctcaggagc cgtattattc gacggcggtg      1140
     ggattgcttc actatgggaa agagtcacat cttaacggtg aagctgaagt agaaaaacgt      1200
     gttacagcat cagttggctc gtggatcaag cgactcaata gttggctgcg aaaagagttt      1260
     taa                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page