(data stored in ACNUC7421 zone)

EMBL: CP001509.GAM

CP001509.GAM         Location/Qualifiers
FT   CDS_pept        complement(757937..758353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gam"
FT                   /locus_tag="ECD_10014"
FT                   /product="host-nuclease inhibitor protein Gam"
FT                   /note="similar to lambdap42"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10014"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42596"
FT                   /protein_id="ACT42596.1"
FT                   /translation="MDINTETEIKQKHSLTPFPVFLISPAFRGRYFHSYFRSSAMNAYY
FT                   IQDRLEAQSWARHYQQLAREEKEAELADDMEKGLPQHLFESLCIDHLQRHGASKKSITR
FT                   AFDDDVEFQERMAEHIRYMVETIAHHQVDIDSEV"
     atggatatta atactgaaac tgagatcaag caaaagcatt cactaacccc ctttcctgtt        60
     ttcctaatca gcccggcatt tcgcgggcga tattttcaca gctatttcag gagttcagcc       120
     atgaacgctt attacattca ggatcgtctt gaggctcaga gctgggcgcg tcactaccag       180
     cagctcgccc gtgaagagaa agaggcagaa ctggcagacg acatggaaaa aggcctgccc       240
     cagcacctgt ttgaatcgct atgcatcgat catttgcaac gccacggggc cagcaaaaaa       300
     tccattaccc gtgcgtttga tgacgatgtt gagtttcagg agcgcatggc agaacacatc       360
     cggtacatgg ttgaaaccat tgctcaccac caggttgata ttgattcaga ggtataa          417
//

If you have problems or comments...

PBIL Back to PBIL home page