(data stored in ACNUC7421 zone)

EMBL: CP001509.GLTI

CP001509.GLTI        Location/Qualifiers
FT   CDS_pept        complement(645850..646758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltI"
FT                   /locus_tag="ECD_00623"
FT                   /product="glutamate/aspartate periplasmic binding protein"
FT                   /note="similar to b0655"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00623"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42499"
FT                   /protein_id="ACT42499.1"
FT                   /translation="MQLRKPAIAILALALSAGLAQADDAAPAAGSTLDKIAKNGVIVVG
FT                   HRESSVPFSYYDNQQKVVGYSQDYSNAIVEAVKKKLNKPDLQVKLIPITSQNRIPLLQN
FT                   GTFDFECGSTTNNVERQKQAAFSDTIFVVGTRLLTKKGGDIKDFADLKGKAVVVTSGTT
FT                   SEVLLNKLNEEQKMNMRIISAKDHGDSFRTLESGRAVAFMMDDALLAGERAKAKKPDNW
FT                   EIVGKPQSQEAYGCMLRKDDPQFKKLMDDTIAQVQTSGEAEKWFDKWFKNPIPPKNLNM
FT                   NFELSDEMKALFKEPNDKALN"
     atgcaattac gtaaacctgc catagcaatc ctggccctgg cgctttccgc aggactggca        60
     caggcagatg acgccgcccc ggcagcgggc agtacgctgg acaaaatcgc caaaaacggt       120
     gtgattgtcg tcggtcaccg tgaatcttca gtacctttct cttattacga caatcagcaa       180
     aaagtggtgg gttactcgca ggattactcc aacgccattg ttgaagcagt gaaaaagaaa       240
     ctcaacaaac cggacttgca ggtgaaactg attccgatta cctcacaaaa ccgtattcca       300
     ctgctgcaaa acggcacttt cgattttgaa tgtggttcta ccactaacaa cgtcgaacgc       360
     caaaaacagg cggctttctc tgacactatt ttcgtggtcg gtacgcgcct gcttaccaaa       420
     aagggcggcg atatcaaaga ttttgccgat ctgaaaggca aagccgtagt cgtcacttct       480
     ggcactacct ctgaagtttt gctcaacaaa ctgaatgaag agcaaaaaat gaatatgcgc       540
     atcatcagcg ccaaagatca cggtgactct ttccgcaccc tggaaagcgg tcgtgccgtt       600
     gcctttatga tggatgacgc tctgctggcc ggtgaacgtg cgaaagcgaa gaaaccagac       660
     aactgggaaa tcgtcggcaa gccgcagtct caggaggcct acggttgtat gttgcgtaaa       720
     gatgatccgc agttcaaaaa gctgatggat gacaccatcg ctcaggtgca gacctccggt       780
     gaagcggaaa aatggtttga taagtggttc aaaaatccca ttccgccgaa aaacctgaac       840
     atgaatttcg aactgtcaga cgaaatgaaa gcactgttca aagaaccgaa tgacaaagca       900
     ctgaactaa                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page