(data stored in ACNUC7421 zone)

EMBL: CP001509.GLXK

CP001509.GLXK        Location/Qualifiers
FT   CDS_pept        511033..512178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glxK"
FT                   /locus_tag="ECD_00464"
FT                   /product="glycerate kinase II"
FT                   /EC_number="2.7.1.31"
FT                   /note="similar to b0514"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00464"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42363"
FT                   /protein_id="ACT42363.1"
FT                   /translation="MKIVIAPDSFKESLSAEKCCQAIKAGFSTLFPDANYICLPIADGG
FT                   EGTVDAMVAATGGNIVTLEVCGPMGEKVNAFYGLTGDGKTAVIEMAAASGLMLVAPEKR
FT                   NPLLASSFGTGELIRHALDNGIRHIILGIGGSATVDGGMGMAQALGVRFLDADGQVLVA
FT                   NGGNLARVASIEMDECDPRLANCHIEVACDVDNPLVGARGAAAVFGPQKGATPEMVEEL
FT                   EQGLQNYARVLQQQTEINVCQMAGGGAAGGMGIAAAVFLNADIKPGIEIVLNAVNLAQA
FT                   VQGAALVITGEGRIDSQTAGGKAPLGVASVAKQFNVPVIGIAGVLGDGVEVVHQYGIDA
FT                   VFSILPRLAPLAEVLASGETNLFNSARNIACAIKIGQGIKN"
     atgaagattg tcattgcgcc agactctttt aaagagagct taagtgcaga aaaatgttgt        60
     caggcaatta aagccgggtt ttcgaccctc tttcccgatg cgaactatat ctgtttgccg       120
     atagcggatg gcggcgaagg aacggtggat gcgatggtcg ccgcgacggg cggcaacatc       180
     gtgacgcttg aagtctgcgg gccgatgggc gaaaaagtga atgcttttta tggccttacc       240
     ggcgacggga aaacggcggt gattgagatg gcggcagcaa gtggcctgat gctggtcgcg       300
     cctgaaaagc gtaatccgtt gctggcctcc agttttggta cgggggagtt aattcgtcat       360
     gcgctggata acggcattcg ccatattatt ctcggcattg gcggcagtgc gacggtcgac       420
     ggtggtatgg gtatggcgca ggcgctcggt gtgcgtttcc ttgatgccga cggtcaggtg       480
     ctggtggcta acggcggtaa tttagcgcgc gtggcaagca ttgagatgga tgaatgcgat       540
     ccgcgtctgg cgaattgcca tattgaagta gcatgtgacg ttgataaccc gctggtaggg       600
     gcacgcggcg cggcggcggt gtttggcccg caaaaagggg caacgccgga aatggtcgaa       660
     gaactggaac aggggctgca aaattacgcc cgtgttttac aacagcaaac ggaaattaat       720
     gtctgccaga tggcgggcgg cggcgctgcg ggcggtatgg gtattgcggc ggcggtattt       780
     ctcaatgcgg atattaaacc gggtattgag attgtgttga atgcggtcaa tcttgcgcag       840
     gcagtgcagg gtgcagcact ggtgatcacc ggggaagggc gcatcgactc gcaaacggca       900
     ggcggtaaag cgccgctggg tgtggcgtcg gtggcgaagc agtttaatgt accggtgatt       960
     gggattgctg gcgtattggg tgatggcgtg gaagtggtgc accagtacgg cattgatgcg      1020
     gtattcagca ttttgccacg tctggcacct ttagccgaag tgctcgccag cggtgaaacc      1080
     aatctcttca acagcgcgcg aaatattgcc tgcgccatta aaataggtca gggaattaaa      1140
     aactga                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page