(data stored in ACNUC7421 zone)

EMBL: CP001509.GSK

CP001509.GSK         Location/Qualifiers
FT   CDS_pept        469171..470475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsk"
FT                   /locus_tag="ECD_00428"
FT                   /product="inosine/guanosine kinase"
FT                   /EC_number="2.7.1.73"
FT                   /note="similar to b0477"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00428"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42327"
FT                   /protein_id="ACT42327.1"
FT                   /translation="MKFPGKRKSKHYFPVNARDPLLQQFQPENETSAAWVVGIDQTLVD
FT                   IEAKVDDEFIERYGLSAGHSLVIEDDVAEALYQELKQKNLITHQFAGGTIGNTMHNYSV
FT                   LADDRSVLLGVMCSNIEIGSYAYRYLCNTSSRTDLNYLQGVDGPIGRCFTLIGESGERT
FT                   FAISPGHMNQLRAESIPEDVIAGASALVLTSYLVRCKPGEPMPEATMKAIEYAKKYNVP
FT                   VVLTLGTKFVIAENPQWWQQFLKDHVSILAMNEDEAEALTGESDPLLASDKALDWVDLV
FT                   LCTAGPIGLYMAGFTEDEAKRKTQHPLLPGAIAEFNQYEFSRAMRHKDCQNPLRVYSHI
FT                   APYMGGPEKIMNTNGAGDGALAALLHDITANSYHRSNVPNSSKHKFTWLTYSSLAQVCK
FT                   YANRVSYQVLNQHSPRLTRGLPEREDSLEESYWDR"
     atgaaatttc ccggtaaacg taaatccaaa cattacttcc ctgtaaatgc acgcgatccg        60
     ctgcttcagc agttccagcc agaaaacgaa accagcgccg cctgggtagt gggtatcgat       120
     caaacgctgg tcgatattga agcgaaagtg gatgacgaat tcattgagcg ttatggatta       180
     agcgccgggc attcactggt gattgaggat gacgtagccg aagcgcttta tcaggaacta       240
     aaacagaaaa acctgattac ccatcagttt gcgggtggca ctattggtaa caccatgcac       300
     aactactcgg tgctcgcgga cgaccgttcg gtgctgctgg gcgtcatgtg cagcaatatt       360
     gaaattggca gctatgccta tcgttacctg tgtaacacct ccagccgtac cgatcttaac       420
     tatctacaag gcgtggatgg tccgattggt cgttgcttta cgctgattgg cgagtccggg       480
     gaacgtacct ttgctatcag ccctggccac atgaaccagc tgcgggctga aagtattccg       540
     gaagatgtga ttgccggagc ctcggcactg gttctcacct cttatctggt gcgttgcaag       600
     ccgggtgaac ccatgccgga agcaaccatg aaagccattg agtacgcgaa gaaatataac       660
     gtaccggtgg tgctgacgct gggaactaag tttgtcattg ccgagaatcc gcagtggtgg       720
     cagcaattcc tcaaagacca cgtctctatc cttgcgatga acgaagatga agccgaagcg       780
     ttgaccggag aaagcgatcc gttgttggca tctgacaagg cgctggactg ggtagatctg       840
     gtgctgtgca ccgccgggcc aatcggcttg tatatggcgg gctttaccga agacgaagcg       900
     aaacgtaaaa cccagcatcc gctgctgccg ggcgctatag cggaattcaa ccagtatgag       960
     tttagccgcg ccatgcgcca caaggattgc cagaatccgc tgcgtgtata ttcgcacatt      1020
     gcgccgtaca tgggcgggcc ggaaaaaatc atgaacacta atggagcggg ggatggcgca      1080
     ttggcagcgt tgctgcatga cattaccgcc aacagctacc atcgtagcaa cgtaccaaac      1140
     tccagcaaac ataaattcac ctggttaact tattcatcgt tagcgcaggt gtgtaaatat      1200
     gctaaccgtg tgagctatca ggtactgaac cagcattcac ctcgtttaac gcgcggcttg      1260
     ccggagcgtg aagacagcct ggaagagtct tactgggatc gttaa                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page