(data stored in ACNUC7421 zone)

EMBL: CP001509.HTGA

CP001509.HTGA        Location/Qualifiers
FT   CDS_pept        10828..11313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htgA"
FT                   /locus_tag="ECD_00012"
FT                   /product="hypothetical protein"
FT                   /note="similar to b0012"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00012"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41914"
FT                   /protein_id="ACT41914.1"
FT                   /translation="MRVNWLESKCDTPFANNLSFISSGSSSSSSFTLASTACRNSCLCS
FT                   SSIFFQVLRRNCSSNCCSISNVDISLSAFSFNRFETSSKMARYNLPCPRSLLAILSPPK
FT                   CCNSPAISCQLRRCCSGCPSIDLNSSLRISTLERRVLPFSLWVSNRAKFANCSSLQC"
     atgcgggtca attggctgga aagcaaatgc gacacgcctt ttgccaataa tttgtctttc        60
     atcagcagcg gcagcagctc ttccagctca ttcaccctgg catcgaccgc gtgcagaaac       120
     tcctgcttat gttcctcgtc catattcttc caggtgttac gcagaaattg ttccagtaac       180
     tgttgctcaa tctcaaacgt agacatctct ttgtcggctt tcagcttcaa tcgttttgaa       240
     acatcgagca aaatggcccg atacaattta ccgtgtccgc gcagtttgtt ggcgatacta       300
     tcgccaccaa aatgctgtaa ttctccagca atcagctgcc agttgcggcg atgttgctcg       360
     ggatgccctt ccatcgattt aaacagttcg ttgcgtatca gtacgctgga gaggcgagtt       420
     ttgccttttt cattatgggt gagcaatcgg gcgaaatttg ccaactgttc ctcactacaa       480
     tgctga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page