(data stored in ACNUC7421 zone)

EMBL: CP001509.HTRE

CP001509.HTRE        Location/Qualifiers
FT   CDS_pept        complement(155671..158271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrE"
FT                   /locus_tag="ECD_00138"
FT                   /product="putative outer membrane usher protein"
FT                   /note="similar to b0139"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00138"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42039"
FT                   /protein_id="ACT42039.1"
FT                   /translation="MTIKPTKNYHNHLTRIATFCALLYCNSAFCAELVEYDHTFLMGQN
FT                   ASNIDLSRYSEGNPAIPGMYDLSVYVNDQPIINQSITFIEIEGKKNAQACITLKNLLQF
FT                   HINSPDINNEKAVLLARDETLGNCLNLTKIIPQASVRYDVNEQRLDIDVPQAWVMKNYQ
FT                   NYVDPSLWENGINAAMLSYNLNGYHSETPGRRNDSIYAAFNGGMNLGAWRLRASGNYNW
FT                   MTDSGSNYDFKNRYIQRDIASLRSQLILGESYTTGETFDSVSIRGIRLYSDSRMLPPTL
FT                   ASFAPIIHGVANTNAKVTITQGGYKIYETTVPPGAFVIDDLSPSGYGSDLIVTVEESDG
FT                   SKRTFSQPFSSVVQMLRPGVGRWDISGGQVLKDDIQDEPNLFQASYYYGLNNYLTGYTG
FT                   IQITDNNYTAGLLGLGLNTSVGAFSFDVTHSNVRIPDDKTYQGQSYRVSWNKLFEETST
FT                   SLNIAAYRYSTQNYLGLNDALTLIDEVKHPEQDLEPKSMRNYSRMKNQVTVSINQPLKF
FT                   EKKDYGSFYLSGSWSDYWASGQNRSNYSIGYSNSASWGSYSVSAQRSWNEDGDTDDSVY
FT                   LSFTIPIEKLLGTEQRTSGFQSIDTQMSSDFKGNNQLNVSSSGYSDNARVSYSVNTGYT
FT                   MNKASKDLSYVGGYASYESPWGTLAGSVSANSDNSRQVSLSTDGGFVLHSGGLTFSNDS
FT                   FSDSDTLAVVQAPGAQGARINYGNSTIDRWGYGVTSALSPYHENRIALDINDLENDVEL
FT                   KSTSAVAVPRQGSVVFADFETVQGQSAIMNITRSDGKNIPFAADIYDEQGNVIGNVGQG
FT                   GQAFVRGIEQQGNISIKWLEESKPVSCLAHYQQSSEAEKIAQSIILNGIRCQIQ"
     gtgactataa aaccaactaa aaattatcat aatcatctga cccgtatcgc tacgttttgc        60
     gcgctgctgt attgcaatag tgctttctgt gctgaacttg ttgaatatga ccataccttc       120
     ctgatggggc agaatgcctc aaatattgat ctcagccggt atagtgaagg taaccctgct       180
     ataccgggta tgtacgacct cagtgtttat gtcaacgatc aacctattat taaccaaagc       240
     attacattta ttgaaattga aggaaaaaaa aacgcacaag cctgtatcac acttaagaat       300
     ttattgcagt ttcatataaa ttctcccgat ataaataacg aaaaagccgt tctgcttgcc       360
     agggatgaaa cactcggcaa ttgccttaat ttgacgaaaa ttatccctca ggcttctgtt       420
     cgttatgacg ttaacgagca acgtctggat atagacgttc ctcaggcatg ggtaatgaaa       480
     aattaccaaa actatgttga tccatcgtta tgggaaaatg gcattaatgc ggccatgttg       540
     tcatacaacc tcaacggata tcatagtgaa actcctggtc gaagaaatga cagcatttat       600
     gctgctttta acggtgggat gaatttaggt gcatggcgac tgcgtgcctc aggcaactac       660
     aactggatga ccgattctgg cagtaattat gattttaaga atcggtatat acagcgtgat       720
     atcgcctcgc tgcgttctca actcattctt ggtgagtctt atacaacggg cgaaaccttt       780
     gattctgtca gtatccgcgg cattcgttta tacagcgaca gccgcatgtt gcctccgaca       840
     ttagcgagtt ttgcgcctat cattcatggc gttgctaata ccaacgccaa agtcactatt       900
     acgcaaggtg gctataagat ttatgaaacg actgtgccgc caggcgcttt cgtcattgat       960
     gatctgagtc cgtcaggtta cggcagcgat cttattgtta ctgtcgaaga atccgatggc      1020
     tcaaagcgga cattctcgca acctttttca tcggtcgttc aaatgttacg ccctggcgtt      1080
     ggacgttggg atattagcgg cggccaggtc ttaaaagatg atattcagga tgagcctaat      1140
     ttatttcagg ccagctacta ctacggtctg aataactatc taacgggtta tactggtatt      1200
     cagattaccg ataataacta taccgctggt ttgttaggtc ttggtctgaa tacttcagtc      1260
     ggtgcatttt ctttcgatgt gactcactcc aatgttcgta taccggatga taaaacatat      1320
     cagggacaaa gttatcgtgt ttcctggaac aagttattcg aagaaacaag tacttcactg      1380
     aatatcgcgg cctatcgcta ttcgacacag aattaccttg gtcttaatga tgcactaact      1440
     ctaattgatg aagtgaaaca tcccgaacaa gatcttgaac cgaaatccat gcgtaattac      1500
     tcgcgcatga aaaatcaggt tacggtcagt attaaccaac cgctaaaatt tgagaaaaaa      1560
     gattacggtt cattttatct ttccggaagt tggtccgatt actgggcttc cggacaaaat      1620
     cgtagcaatt actctattgg ctacagtaac agtgcatcct ggggcagcta cagtgtcagt      1680
     gcccagcgtt catggaatga agacggcgac actgacgata gcgtttatct cagtttcacc      1740
     attcctattg aaaaattact tggcactgaa caacggactt caggtttcca gagtattgat      1800
     actcaaatga gcagtgactt taagggtaat aaccaactca acgtcagtag cagtggctat      1860
     agtgataacg ctcgcgtcag ttatagcgta aatactggct atacgatgaa taaagccagc      1920
     aaagatttga gttatgttgg gggttatgcc agctatgaat caccgtgggg aaccctggca      1980
     ggttcagttt ctgcaaatag cgataacagt cgtcaagtgt ctctcagcac cgacggtggt      2040
     tttgtattgc atagcggcgg cctgaccttc agtaatgaca gttttagcga ctccgataca      2100
     ctggcggtag ttcaggctcc aggtgctcaa ggagcgcgaa taaattatgg caacagtact      2160
     atcgatcgat ggggttatgg tgtcaccagc gctctttctc cttatcatga aaaccgtatc      2220
     gcgctggata tcaacgatct tgagaacgat gttgaattaa aaagtaccag tgcagtagct      2280
     gtaccgcgtc agggttcagt cgtctttgct gattttgaaa ccgtgcaagg gcaatcagcc      2340
     attatgaaca tcacacgaag tgatggtaaa aatattccat ttgctgcaga tatttatgat      2400
     gagcaaggca atgtcattgg taatgttgga cagggtggac aagcatttgt tcgtggtatt      2460
     gagcagcagg gaaatatcag cattaaatgg ctcgaagaaa gtaaacccgt aagttgtctt      2520
     gcgcattatc aacaaagttc agaagcagaa aaaatagcgc aatctattat tctgaatgga      2580
     attcggtgtc agattcagta a                                                2601
//

If you have problems or comments...

PBIL Back to PBIL home page