(data stored in ACNUC7421 zone)

EMBL: CP001509.HUPB

CP001509.HUPB        Location/Qualifiers
FT   CDS_pept        430485..430757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupB"
FT                   /locus_tag="ECD_00392"
FT                   /product="HU, DNA-binding transcriptional regulator, beta
FT                   subunit"
FT                   /note="similar to b0440"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00392"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42291"
FT                   /protein_id="ACT42291.1"
FT                   /translation="MNKSQLIDKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALV
FT                   GFGTFAVKERAARTGRNPQTGKEITIAAAKVPSFRAGKALKDAVN"
     gtgaataaat ctcaattgat cgacaagatt gctgcagggg ctgatatctc taaagctgcg        60
     gctggccgtg cgttagatgc tattattgct tccgtaactg aatctctgaa agaaggggat       120
     gatgtagcac tggtaggttt tggtactttt gccgttaaag agcgtgctgc ccgtactggc       180
     cgcaacccgc agaccggtaa agagatcacc atcgctgctg ctaaagtacc gagcttccgt       240
     gcaggtaaag cactgaaaga cgcggtaaac taa                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page