(data stored in ACNUC7421 zone)

EMBL: CP001509.ILVH

CP001509.ILVH        Location/Qualifiers
FT   CDS_pept        90162..90653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="ECD_00080"
FT                   /product="acetolactate synthase 3, small subunit,
FT                   valine-sensitive"
FT                   /EC_number="2.2.1.6"
FT                   /note="similar to b0078"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00080"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41981"
FT                   /protein_id="ACT41981.1"
FT                   /translation="MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSR
FT                   MTIQTVGDEKVLEQIEKQLHKLVDVLRVSELGQGAHVEREIMLVKIQASGYGRDEVKRN
FT                   TEIFRGQIIDVTPSLYTVQLAGTSGKLDAFLASIRDVAKIVEVARSGVVGLSRGDKIMR
FT                   "
     atgcgccgga tattatcagt cttactcgaa aatgaatcag gcgcgttatc ccgtgtgatt        60
     ggcctttttt cccagcgtgg ctacaacatt gaaagcctga ccgttgcgcc aaccgacgat       120
     ccgacattat cgcgtatgac catccagacc gtgggcgatg aaaaagtact tgagcagatc       180
     gaaaagcaat tacacaaact ggtcgatgtc ttgcgcgtga gtgagttggg gcagggcgcg       240
     catgttgagc gggaaatcat gctggtgaaa attcaggcca gcggttacgg gcgtgacgaa       300
     gtgaaacgta atacggaaat attccgtggg caaattatcg atgtcacacc ctcgctttat       360
     accgttcaat tagcaggcac cagcggtaag cttgatgcat ttttagcatc gattcgcgat       420
     gtggcgaaaa ttgtggaggt tgctcgctct ggtgtggtcg gactttcgcg cggcgataaa       480
     ataatgcgtt ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page