(data stored in ACNUC7421 zone)

EMBL: CP001509.ILVI

CP001509.ILVI        Location/Qualifiers
FT   CDS_pept        88435..90159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvI"
FT                   /locus_tag="ECD_00079"
FT                   /product="acetolactate synthase 3 large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="similar to b0077"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00079"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41980"
FT                   /protein_id="ACT41980.1"
FT                   /translation="MEMLSGAEMVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIDH
FT                   VLVRHEQAAVHMADGLARATGEVGVVLVTSGPGATNAITGIATAYMDSIPLVVLSGQVA
FT                   TSLIGYDAFQECDMVGISRPVVKHSFLVKQTEDIPQVLKKAFWLAASGRPGPVVVDLPK
FT                   DILNPANKLPYVWPESVSMRSYNPTTTGHKGQIKRALQTLVAAKKPVVYVGGGAITAGC
FT                   HQQLKEMVEALNLPVVSSLMGLGAFPATHRQALGMLGMHGTYEANMTMHNADVIFAVGV
FT                   RFDDRTTNNLAKYCPNATVLHIDIDPTSISKTVTADIPIVGDARQVLEQMLELLSQESA
FT                   HQPLDEIRDWWQQIEQWRARQCLKYDTHSEKIKPQAVIETLWRLTKGDAYVTSDVGQHQ
FT                   MFAALYYPFDKPRRWINSGGLGTMGFGLPAALGVKMALPEETVVCVTGDGSIQMNIQEL
FT                   STALQYELPVLVVNLNNRYLGMVKQWQDMIYSGRHSQSYMQSLPDFVRLAEAYGHVGIQ
FT                   ISHPHELESKLSEALEQVRNNRLVFVDVTVDGSEHVYPMQIRGGGMDEMWLSKTERT"
     atggagatgt tgtctggagc cgagatggtc gtccgatcgc ttatcgatca gggcgttaaa        60
     caagtattcg gttatcccgg aggcgcagtc cttgatattt atgatgcatt gcataccgtg       120
     ggtggtattg atcatgtatt agttcgtcat gagcaggcgg cggtgcatat ggccgatggc       180
     ctggcgcgcg cgaccgggga agtcggcgtc gtgctggtaa cgtcgggtcc aggggcgacc       240
     aatgcgatta ctggcatcgc caccgcttat atggattcca ttccattagt tgtcctttcc       300
     gggcaggtag cgacctcgtt gataggttac gatgcctttc aggagtgcga catggtgggg       360
     atttcgcgac cggtggttaa acacagtttt ctggttaagc aaacggaaga cattccgcag       420
     gtgctgaaaa aggctttctg gctggcggca agtggtcgcc caggaccagt agtcgttgat       480
     ttaccgaaag atattcttaa tccggcgaac aaattaccct atgtctggcc ggagtcggtc       540
     agtatgcgtt cttacaatcc cactactacc ggacataaag ggcaaattaa gcgtgctctg       600
     caaacgctgg tggcggcaaa aaaaccggtt gtctacgtag gtggtggggc aatcacggcg       660
     ggctgccatc agcagttgaa agaaatggtg gaggcgttga atctgcccgt tgtttcctca       720
     ttgatggggc tgggggcgtt tccggcaacg catcgtcagg cactgggcat gctgggaatg       780
     cacggtacct acgaagccaa tatgacgatg cataacgcgg atgtgatttt cgccgtcggg       840
     gtacgatttg atgaccgaac gacgaacaat ctggcaaagt actgcccaaa tgccactgtt       900
     ctgcatatcg atattgatcc tacttccatt tctaaaaccg tgactgcgga tatcccgatt       960
     gtgggggatg ctcgccaggt cctcgaacaa atgcttgaac tcttgtcgca agaatccgcc      1020
     catcaaccgc tggatgagat ccgcgactgg tggcagcaaa ttgaacagtg gcgcgctcgt      1080
     cagtgcctga aatatgacac tcacagtgaa aagattaaac cgcaggcggt gatcgagact      1140
     ctttggcggt tgacgaaggg agacgcttac gtgacgtccg atgtcgggca gcaccagatg      1200
     tttgctgcac tttattatcc attcgacaaa ccgcgtcgct ggatcaattc cggtggcctc      1260
     ggcacgatgg gttttggttt acctgcggca ctgggcgtca aaatggcgtt gccagaagaa      1320
     accgtggttt gcgtcactgg cgacggcagt attcagatga acatccagga actgtctacc      1380
     gcgttgcaat acgagttgcc cgtactggtg gtgaatctca ataaccgcta tctggggatg      1440
     gtgaagcagt ggcaggacat gatctattcc ggccgtcatt cacaatctta tatgcaatcg      1500
     ctacccgatt tcgtccgtct ggcggaagcc tatgggcatg tcgggatcca gatttctcat      1560
     ccgcatgagc tggaaagcaa acttagcgag gcgctggaac aggtgcgcaa taatcgcctg      1620
     gtgtttgttg atgttaccgt cgatggcagc gagcacgtct acccgatgca gattcgcggg      1680
     ggcggaatgg atgaaatgtg gttaagcaaa acggagagaa cctga                      1725
//

If you have problems or comments...

PBIL Back to PBIL home page