(data stored in ACNUC7421 zone)

EMBL: CP001509.INSA-4

CP001509.INSA-4      Location/Qualifiers
FT   CDS_pept        complement(350680..350955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insA-4"
FT                   /locus_tag="ECD_00314"
FT                   /product="IS1 protein InsA"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00314"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42213"
FT                   /protein_id="ACT42213.1"
FT                   /translation="MASVSISCPSCSATDGVVRNGKSTAGHQRYLCSHCRKTWQLQFTY
FT                   TASQPGTHQKIIDMAMNGVGCRATARIMGVGLNTILRHLKNSGRSR"
     gtggcttctg tttctatcag ctgtccctcc tgttcagcta ctgacggggt ggtgcgtaac        60
     ggcaaaagca ccgccggaca tcagcgctat ctctgctctc actgccgtaa aacatggcaa       120
     ctgcagttca cttacaccgc ttctcaaccc ggtacgcacc agaaaatcat tgatatggcc       180
     atgaatggcg ttggatgccg ggcaactgcc cgcattatgg gcgttggcct caacacgatt       240
     ttacgtcact taaaaaactc aggccgcagt cggtaa                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page