(data stored in ACNUC7421 zone)

EMBL: CP001509.INSB-2

CP001509.INSB-2      Location/Qualifiers
FT   CDS_pept        241509..242012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insB-2"
FT                   /locus_tag="ECD_00211"
FT                   /product="IS1 protein InsB"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00211"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42112"
FT                   /protein_id="ACT42112.1"
FT                   /translation="MPGNCPHYGRWPQHDFTSLKKLRPQSVTSRIQPGSDVIVCAEMDE
FT                   QWGYVGAKSRQRWLFYAYDSLRKTVVAHVFGERTMATLGRLMSLLSPFDVVIWMTDGWP
FT                   LYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNI
FT                   KHYQ"
     atgccgggca actgcccgca ttatgggcgt tggcctcaac acgattttac gtcacttaaa        60
     aaactcaggc cgcagtcggt aacctcgcgc atacagccgg gcagtgacgt catcgtctgc       120
     gcggaaatgg acgaacagtg gggctatgtc ggggctaaat cgcgccagcg ctggctgttt       180
     tacgcgtatg acagtctccg gaagacggtt gttgcgcacg tattcggtga acgcactatg       240
     gcgacgctgg ggcgtcttat gagcctgctg tcaccctttg acgtggtgat atggatgacg       300
     gatggctggc cgctgtatga atcccgcctg aagggaaagc tgcacgtaat cagcaagcga       360
     tatacgcagc gaattgagcg gcataacctg aatctgaggc agcacctggc acggctggga       420
     cggaagtcgc tgtcgttctc aaaatcggtg gagctgcatg acaaagtcat cgggcattat       480
     ctgaacataa aacactatca ataa                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page