(data stored in ACNUC7421 zone)

EMBL: CP001509.INSJ-2

CP001509.INSJ-2      Location/Qualifiers
FT   CDS_pept        642514..643035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insJ-2"
FT                   /locus_tag="ECD_00619"
FT                   /product="IS150 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00619"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42495"
FT                   /protein_id="ACT42495.1"
FT                   /translation="MSKPKYPFEKRLEVVNHYFTTDDGYRIISARFGVPRTQVRTWVAL
FT                   YEKHGEKGLIPKPKGVSADPELRIKVVKAVIEQHMSLNQAAAHFMLAGSGSVARWLKVY
FT                   EERGEAGLRALKIGTKRNIAISVDPEKAASALELSKDRRIEDLERQVRFLETRLMYLKK
FT                   LKALAHPTKK"
     atgtcaaagc caaaataccc ttttgaaaag cgccttgaag tcgtgaatca ctacttcaca        60
     actgatgatg gttacaggat catctcggca cgttttggtg tcccccgaac ccaggtcagg       120
     acatgggttg ccctctatga aaaacatgga gaaaaaggtt taattcccaa acctaaaggc       180
     gttagtgctg atccagagtt gcgtattaag gtcgtgaaag ctgtgatcga gcagcacatg       240
     tcccttaatc aggctgctgc tcactttatg cttgctggta gtggttctgt agccaggtgg       300
     ctgaaggtct atgaagagcg cggagaagct ggtttacgcg cgctcaagat tggcaccaaa       360
     agaaacattg caatatcagt tgatccagaa aaagcggcat cagcattgga gctgtcaaaa       420
     gaccgacgca ttgaggatct tgaaaggcaa gttcgatttc ttgaaacgcg gcttatgtat       480
     ctaaaaaagc tgaaagcctt agctcatccc acgaaaaagt ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page