(data stored in ACNUC7421 zone)

EMBL: CP001509.INSL-1

CP001509.INSL-1      Location/Qualifiers
FT   CDS_pept        15443..16555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insL-1"
FT                   /locus_tag="ECD_00016"
FT                   /product="IS186 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00016"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41918"
FT                   /protein_id="ACT41918.1"
FT                   /translation="MNYSHDNWSAILAHIGKPEELDTSARNAGALTRRREIRDAATLLR
FT                   LGLAYGPGGMSLREVTAWAQLHDVATLSDVALLKRLRNAADWFGILAAQTLAVRAAVTG
FT                   CTSGKRLRLVDGTAISAPGGGSAEWRLHMGYDPHTCQFTDFELTDSRDAERLDRFAQTA
FT                   DEIRIADRGFGSRPECIRSLAFGEADYIVRVHWRGLRWLTAEGMRFDMMGFLRGLDCGK
FT                   NGETTVMIGNSGNKKAGAPFPARLIAVSLPPEKALISKTRLLSENRRKGRVVQAETLEA
FT                   AGHVLLLTSLPEDEYSAEQVADCYRLRWQIELAFKRLKSLLHLDALRAKEPELAKAWIF
FT                   ANLLAAFLIDDIIQPSLDFPPRSAGSEKKN"
     atgaattact ctcacgataa ctggtcagca attctggccc atattggtaa gcccgaagaa        60
     ctggatactt cggcacgtaa tgccggggct ctaacccgcc gccgcgaaat tcgtgatgct       120
     gcaactctgc tacgtctggg gctggcttac ggccccgggg ggatgtcatt acgtgaagtc       180
     actgcatggg ctcagctcca tgacgttgca acattatctg acgtggctct cctgaagcgg       240
     ctgcggaatg ccgccgactg gtttggcata cttgccgcac aaacacttgc tgtacgcgcc       300
     gcagttacgg gttgtacaag cggaaagaga ttgcgtcttg tcgatggaac agcaatcagt       360
     gcgcccgggg gcggcagcgc tgaatggcga ctacatatgg gatatgatcc tcatacctgt       420
     cagttcactg attttgagct aaccgacagc agagacgctg aacggctgga ccgatttgcg       480
     caaacggcag acgagatacg cattgctgac cggggattcg gttcgcgtcc cgaatgtatc       540
     cgctcacttg cttttggaga agctgattat atcgtccggg ttcactggcg aggattgcgc       600
     tggttaactg cagaaggaat gcgctttgac atgatgggtt ttctgcgcgg gctggattgc       660
     ggtaagaacg gtgaaaccac tgtaatgata ggcaattcag gtaataaaaa agccggagct       720
     ccctttccgg cacgtctcat tgccgtatca cttcctcccg aaaaagcatt aatcagtaaa       780
     acccgactgc tcagcgagaa tcgtcgaaaa ggacgagtag ttcaggcgga aacgctggaa       840
     gcagcgggcc atgtgctatt gctaacatca ttaccggaag atgaatattc agcagagcaa       900
     gtggctgatt gttaccgtct gcgatggcaa attgaactgg cttttaagcg gctcaaaagt       960
     ttgctgcacc tggatgcttt gcgtgcaaag gaacctgaac tcgcgaaagc gtggatattt      1020
     gctaatctac tcgccgcatt tttaattgac gacataatcc agccatcgct ggatttcccc      1080
     cccagaagtg ccggatccga aaagaagaac taa                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page