(data stored in ACNUC7421 zone)

EMBL: CP001509.ISPH

CP001509.ISPH        Location/Qualifiers
FT   CDS_pept        30349..31299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispH"
FT                   /locus_tag="ECD_00033"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase, 4Fe-4S protein"
FT                   /note="similar to b0029"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00033"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41935"
FT                   /protein_id="ACT41935.1"
FT                   /translation="MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHEVVHNRYV
FT                   VDSLRERGAIFIEQISEVPDGAILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHM
FT                   EVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPDDVWKLTVKNEEKLSF
FT                   MTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGS
FT                   KNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR
FT                   LQQLGGGEAIPLEGREENIVFEVPKELRVDIREVD"
     atgcagatcc tgttggccaa cccgcgtggt ttttgtgccg gggtagaccg cgctatcagc        60
     attgttgaaa acgcgctggc catttacggc gcaccgatat atgtccgtca cgaagtggta       120
     cataaccgct atgtggtcga tagcttgcgt gagcgtgggg ctatctttat tgagcagatt       180
     agcgaagtac cggacggcgc gatcctgatt ttctccgcac acggtgtttc tcaggcggta       240
     cgtaacgaag caaaaagccg cgatttgacg gtgtttgatg ccacctgtcc gctggtgacc       300
     aaagtgcata tggaagtcgc ccgcgccagc cgtcgtggcg aagagtcgat tctcatcggc       360
     cacgccgggc atccggaagt ggaaggtacg atgggccagt acagtaaccc ggaaggggga       420
     atgtatctgg tcgaatcgcc ggacgatgtg tggaaactga cggtcaaaaa cgaagagaag       480
     ctctccttta tgacccagac cacgctgtcg gtggatgaca cgtctgatgt gatcgacgcg       540
     ctgcgtaaac gcttcccgaa aattgtcggt ccgcgcaaag atgacatctg ctacgccacg       600
     actaaccgtc aggaagcggt acgcgccctg gcagaacagg cggaagttgt gttggtggtc       660
     ggttcgaaaa actcctccaa ctccaaccgt ctggcggagc tggcccagcg tatgggcaaa       720
     cgcgcgtttt tgattgacga tgcgaaagat atccaggaag agtgggtgaa agaggttaaa       780
     tgcgtcggcg tgactgcggg cgcatcggct ccggatattc tggtgcaaaa tgtggtggca       840
     cgtttgcagc agctgggcgg tggtgaagcc attccgctgg aaggccgtga agaaaacatt       900
     gttttcgaag tgccgaaaga gctgcgtgtc gatattcgtg aagtcgatta a                951
//

If you have problems or comments...

PBIL Back to PBIL home page