(data stored in ACNUC7421 zone)

EMBL: CP001509.J

CP001509.J           Location/Qualifiers
FT   CDS_pept        783980..787378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="J"
FT                   /locus_tag="ECD_10054"
FT                   /product="tail:host specificity protein"
FT                   /note="similar to lambdap21"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10054"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42636"
FT                   /protein_id="ACT42636.1"
FT                   /translation="MGKGSSKGHTPREAKDNLKSTQLLSVIDAISEGPIEGPVDGLKSV
FT                   LLNSTPVLDTEGNTNISGVTVVFRAGEQEQTPPEGFESSGSETVLGTEVKYDTPITRTI
FT                   TSANIDRLRFTFGVQALVETTSKGDRNPSEVRLLVQIQRNGGWVTEKDITIKGKTTSQY
FT                   LASVVMGNLPPRPFNIRMRRMTPDSTTDQLQNKTLWSSYTEIIDVKQCYPNTALVGVQV
FT                   DSEQFGSQQVSRNYHLRGRILQVPSNYNPQTRQYSGIWDGTFKPAYSNNMAWCLWDMLT
FT                   HPRYGMGKRLGAADVDKWALYVIGQYCDQSVPDGFGGTEPRITCNAYLTTQRKAWDVLS
FT                   DFCSAMRCMPVWNGQTLTFVQDRPSDKTWTYNRSNVVMPDDGAPFRYSFSALKDRHNAV
FT                   EVNWIDPNNGWETATELVEDTQAIARYGRNVTKMDAFGCTSRGQAHRAGLWLIKTELLE
FT                   TQTVDFSVGAEGLRHVPGDVIEICDDDYAGISTGGRVLAVNSQTRTLTLDREITLPSSG
FT                   TALISLVDGSGNPVSVEVQSVTDGVKVKVSRVPDGVAEYSVWELKLPTLRQRLFRCVSI
FT                   RENDDGTYAITAVQHVPEKEAIVDNGAHFDGEQSGTVNGVTPPAVQHLTAEVTADSGEY
FT                   QVLARWDTPKVVKGVSFLLRLTVTADDGSERLVSTARTTETTYRFTQLALGNYRLTVRA
FT                   VNAWGQQGDPASVSFRIAAPAAPSRIELTPGYFQITATPHLAVYDPTVQFEFWFSEKQI
FT                   ADIRQVETSTRYLGTALYWIAASINIKPGHDYYFYIRSVNTVGKSAFVEAVGRASDDAE
FT                   GYLDFFKGKITESHLGKELLEKVELTEDNASRLEEFSKEWKDASDKWNAMWAVKIEQTK
FT                   DGKHYVAGIGLSMEDTEEGKLSQFLVAANRIAFIDPANGNETPMFVAQGNQIFMNDVFL
FT                   KRLTAPTITSGGNPPAFSLTPDGKLTAKNADISGSVNANSGTLSNVTIAENCTINGTLR
FT                   AEKIVGDIVKAASAAFPRQRESSVDWPSGTRTVTVTDDHPFDRQIVVLPLTFRGSKRTV
FT                   SGRTTYSMCYLKVLMNGAVIYDGAANEAVQVFSRIVDMPAGRGNVILTFTLTSTRHSAD
FT                   IPPYTFASDVQVMVIKKQALGISVV"
     atgggtaaag gaagcagtaa ggggcatacc ccgcgcgaag cgaaggacaa cctgaagtcc        60
     acgcagttgc tgagtgtgat cgatgccatc agcgaagggc cgattgaagg tccggtggat       120
     ggcttaaaaa gcgtgctgct gaacagtacg ccggtgctgg acactgaggg gaataccaac       180
     atatccggtg tcacggtggt gttccgggct ggtgagcagg agcagactcc gccggaggga       240
     tttgaatcct ccggctccga gacggtgctg ggtacggaag tgaaatatga cacgccgatc       300
     acccgcacca ttacgtctgc aaacatcgac cgtctgcgct ttaccttcgg tgtacaggca       360
     ctggtggaaa ccacctcaaa gggtgacagg aatccgtcgg aagtccgcct gctggttcag       420
     atacaacgta acggtggctg ggtgacggaa aaagacatca ccattaaggg caaaaccacc       480
     tcgcagtatc tggcctcggt ggtgatgggt aacctgccgc cgcgcccgtt taatatccgg       540
     atgcgcagga tgacgccgga cagcaccaca gaccagctgc agaacaaaac gctctggtcg       600
     tcatacactg aaatcatcga tgtgaaacag tgctacccga acacggcact ggtcggcgtg       660
     caggtggact cggagcagtt cggcagccag caggtgagcc gtaattatca tctgcgcggg       720
     cgtattctgc aggtgccgtc gaactataac ccgcagacgc ggcaatacag cggtatctgg       780
     gacggaacgt ttaaaccggc atacagcaac aacatggcct ggtgtctgtg ggatatgctg       840
     acccatccgc gctacggcat ggggaaacgt cttggtgcgg cggatgtgga taaatgggcg       900
     ctgtatgtca tcggccagta ctgcgaccag tcagtgccgg acggctttgg cggcacggag       960
     ccgcgcatca cctgtaatgc gtacctgacc acacagcgta aggcgtggga tgtgctcagc      1020
     gatttctgct cggcgatgcg ctgtatgccg gtatggaacg ggcagacgct gacgttcgtg      1080
     caggaccgac cgtcggataa gacgtggacc tataaccgca gtaatgtggt gatgccggat      1140
     gatggcgcgc cgttccgcta cagcttcagc gccctgaagg accgccataa tgccgttgag      1200
     gtgaactgga ttgacccgaa caacggctgg gagacggcga cagagcttgt tgaagatacg      1260
     caggccattg cccgttacgg tcgtaatgtt acgaagatgg atgcctttgg ctgtaccagc      1320
     cgggggcagg cacaccgcgc cgggctgtgg ctgattaaaa cagaactgct ggaaacgcag      1380
     accgtggatt tcagcgtcgg cgcagaaggg cttcgccatg taccgggcga tgttattgaa      1440
     atctgcgatg atgactatgc cggtatcagc accggtggtc gtgtgctggc ggtgaacagc      1500
     cagacccgga cgctgacgct cgaccgtgaa atcacgctgc catcctccgg taccgcgctg      1560
     ataagcctgg ttgacggaag tggcaatccg gtcagcgtgg aggttcagtc cgtcaccgac      1620
     ggcgtgaagg taaaagtgag ccgtgttcct gacggtgttg ctgaatacag cgtatgggag      1680
     ctgaagctgc cgacgctgcg ccagcgactg ttccgctgcg tgagtatccg tgagaacgac      1740
     gacggcacgt atgccatcac cgccgtgcag catgtgccgg aaaaagaggc catcgtggat      1800
     aacggggcgc actttgacgg cgaacagagt ggcacggtga atggtgtcac gccgccagcg      1860
     gtgcagcacc tgaccgcaga agtcactgca gacagcgggg aatatcaggt gctggcgcga      1920
     tgggacacac cgaaggtggt gaagggcgtg agtttcctgc tccgtctgac cgtaacagcg      1980
     gacgacggca gtgagcggct ggtcagcacg gcccggacga cggaaaccac ataccgcttc      2040
     acgcaactgg cgctggggaa ctacaggctg acagtccggg cggtaaatgc gtgggggcag      2100
     cagggcgatc cggcgtcggt atcgttccgg attgccgcac cggcagcacc gtcgaggatt      2160
     gagctgacgc cgggctattt tcagataacc gccacgccgc atcttgccgt ttatgacccg      2220
     acggtacagt ttgagttctg gttctcggaa aagcagattg cggatatcag acaggttgaa      2280
     accagcacgc gttatcttgg tacggcgctg tactggatag ccgccagtat caatatcaaa      2340
     ccgggccatg attattactt ttatatccgc agtgtgaaca ccgttggcaa atcggcattc      2400
     gtggaggccg tcggtcgggc gagcgatgat gcggaaggtt acctggattt tttcaaaggc      2460
     aagataaccg aatcccatct cggcaaggag ctgctggaaa aagtcgagct gacggaggat      2520
     aacgccagca gactggagga gttttcgaaa gagtggaagg atgccagtga taagtggaat      2580
     gccatgtggg ctgtcaaaat tgagcagacc aaagacggca aacattatgt cgcgggtatt      2640
     ggcctcagca tggaggacac ggaggaaggc aaactgagcc agtttctggt tgccgccaat      2700
     cgtatcgcat ttattgaccc ggcaaacggg aatgaaacgc cgatgtttgt ggcgcagggc      2760
     aaccagatat tcatgaacga cgtgttcctg aagcgcctga cggcccccac cattaccagc      2820
     ggcggcaatc ctccggcctt ttccctgaca ccggacggaa agctgaccgc taaaaatgcg      2880
     gatatcagtg gcagtgtgaa tgcgaactcc gggacgctca gtaatgtgac gatagctgaa      2940
     aactgtacga taaacggtac gctgagggcg gaaaaaatcg tcggggacat tgtaaaggcg      3000
     gcgagcgcgg cttttccgcg ccagcgtgaa agcagtgtgg actggccgtc aggtacccgt      3060
     actgtcaccg tgaccgatga ccatcctttt gatcgccaga tagtggtgct tccgctgacg      3120
     tttcgcggaa gtaagcgtac tgtcagcggc aggacaacgt attcgatgtg ttatctgaaa      3180
     gtactgatga acggtgcggt gatttatgat ggcgcggcga acgaggcggt acaggtgttc      3240
     tcccgtattg ttgacatgcc agcgggtcgg ggaaacgtga tcctgacgtt cacgcttacg      3300
     tccacacggc attcggcaga tattccgccg tatacgtttg ccagcgatgt gcaggttatg      3360
     gtgattaaga aacaggcgct gggcatcagc gtggtctga                             3399
//

If you have problems or comments...

PBIL Back to PBIL home page