(data stored in ACNUC7421 zone)

EMBL: CP001509.KDPA

CP001509.KDPA        Location/Qualifiers
FT   CDS_pept        complement(686933..688606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpA"
FT                   /locus_tag="ECD_00655"
FT                   /product="potassium translocating ATPase, subunit A"
FT                   /EC_number="3.6.3.9"
FT                   /note="similar to b0698"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00655"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42531"
FT                   /protein_id="ACT42531.1"
FT                   /translation="MAAQGFLLIATFLLVLMVLARPLGSGLARLINDIPLPGTTGVERV
FT                   LFRALGVSDREMNWKQYLCAILGLNMLGLAVLFFMLLGQHYLPLNPQQLPGLSWDLALN
FT                   TAVSFVTNTNWQSYSGETTLSYFSQMAGLTVQNFLSAASGIAVIFALIRAFTRQSMSTL
FT                   GNAWVDLLRITLWVLVPVALLIALFFIQQGALQNFLPYQAVNTVEGAQQLLPMGPVASQ
FT                   EAIKMLGTNGGGFFNANSSHPFENPTALTNFVQMLAIFLIPTALCFAFGEVTGDRRQGR
FT                   MLLWAMSVIFVICVGVVMWAEVQGNPHLLALGTDSSINMEGKESRFGVLVSSLFAVVTT
FT                   AASCGAVIAMHDSFTALGGMVPMWLMQIGEVVFGGVGSGLYGMMLFVLLAVFIAGLMIG
FT                   RTPEYLGKKIDVREMKLTALAILVTPTLVLMGAALAMMTDAGRSAMLNPGPHGFSEVLY
FT                   AVSSAANNNGSAFAGLSANSPFWNCLLAFCMFVGRFGVIIPVMAIAGSLVSKKSQAASS
FT                   GTLPTHGPLFVGLLIGTVLLVGALTFIPALALGPVAEYLS"
     atggctgcgc aagggttctt actgatcgcc acgtttttac tggtgttaat ggtgctggcg        60
     cgtcctttag gcagcgggct ggcgcggctg attaatgaca ttcctcttcc cggtacaacg       120
     ggcgttgagc gcgtactttt tcgcgcactt ggcgtctctg accgtgagat gaactggaag       180
     caatatcttt gtgccattct cggcctgaac atgctggggc tggcggtgct gttttttatg       240
     ttgctcggtc agcactatct gccgcttaat ccacagcagt tgccagggct gtcgtgggat       300
     ctggcgctga ataccgccgt cagctttgtc accaatacca actggcaatc ttatagcggt       360
     gaaaccacgt tgagctattt cagccagatg gcgggcttaa cggtgcaaaa ctttctttct       420
     gccgccagcg ggattgcggt gatttttgcc ctcatccgtg cgtttacccg ccagagcatg       480
     agcacgctcg ggaatgcctg ggtcgatctg ctacgcatca cgttatgggt gctagtccct       540
     gtggcgttgt tgattgcact gttttttatt caacaaggtg cgctgcaaaa ctttctgcct       600
     tatcaggctg tgaataccgt tgaaggagcg caacagctgt tacccatggg gcctgtagct       660
     tctcaggaag cgatcaagat gctcggtact aacggcggtg gcttctttaa tgccaactcg       720
     tcgcatccgt ttgaaaaccc aaccgcactg accaacttcg tgcagatgct ggcgatcttc       780
     ttgatcccaa cggcgctgtg ctttgccttt ggtgaagtga cgggcgatcg ccgccagggg       840
     cgcatgttgc tgtgggcgat gtcagtgatt tttgtcatct gcgtaggcgt ggtgatgtgg       900
     gcagaagttc agggtaatcc tcatctgctg gcactgggca cggacagcag catcaatatg       960
     gaaggtaaag agagccgttt cggcgtgctg gtcagtagcc tgtttgcggt cgtgacgacg      1020
     gcggcttcct gtggcgcggt gattgcgatg catgattcgt ttaccgctct cggtggcatg      1080
     gtgccgatgt ggctgatgca aattggtgaa gtggtgttcg gcggtgtcgg ttctggtctt      1140
     tacggcatga tgctgtttgt cctgctggcg gtgtttattg ccgggctgat gattggtcgt      1200
     acaccggaat atctgggtaa aaaaatcgac gtacgcgaga tgaaactgac tgcactggca      1260
     attctggtta ccccgacgct ggtgctgatg ggcgcggcgt tggcgatgat gaccgacgcc      1320
     ggacgtagcg ccatgctcaa ccctggcccg catggtttta gcgaagtgct gtacgccgtg      1380
     tcatccgccg ctaacaacaa cggcagcgcc tttgccggat taagcgccaa ctctccgttc      1440
     tggaactgtt tactggcgtt ctgcatgttt gtcggtcgct tcggggtgat tatcccggtg      1500
     atggcaattg ccggttcgct ggtgagtaaa aagagccaag ccgccagctc cggcacgctg      1560
     ccaacgcacg gcccgctgtt tgttggcctg ttaatcggca ccgtgttgct ggttggcgca      1620
     ctgaccttta tccctgccct ggcgcttggt ccggtggcgg aatatctctc ctga            1674
//

If you have problems or comments...

PBIL Back to PBIL home page