(data stored in ACNUC7421 zone)

EMBL: CP001509.KDPB

CP001509.KDPB        Location/Qualifiers
FT   CDS_pept        complement(684862..686910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpB"
FT                   /locus_tag="ECD_00654"
FT                   /product="potassium translocating ATPase, subunit B"
FT                   /EC_number="3.6.3.9"
FT                   /note="similar to b0697"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00654"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42530"
FT                   /protein_id="ACT42530.1"
FT                   /translation="MSRKQLALFEPTLVVQALKEAVKKLNPQAQWRNPVMFIVWIGSLL
FT                   TTCISIAMASGAMPGNALFSAAISGWLWITVLFANFAEALAEGRSKAQANSLKGVKKTA
FT                   FARKLREPKYGAAEDKVPADQLRKGDIVLVEAGDIIPCDGEVIEGGASVDESAITGESA
FT                   PVIRESGGDFASVTGGTRILSDWLVIECSVNPGETFLDRMIAMVEGAQRRKTPNEIALT
FT                   ILLIALTIVFLLATATLWPFSAWGGNAVSVTVLVALLVCLIPTTIGGLLSAIGVAGMSR
FT                   MLGANVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFIPAQGVDEKTLADAAQLA
FT                   SLADETPEGRSIVILAKQRFNLRERDVQSLHATFVPFTAQSRMSGINIDNRMIRKGSVD
FT                   AIRRHVEANGGHFPADVDQKVDQVARQGATPLVVVEGSRVLGVIALKDIVKGGIKERFA
FT                   QLRKMGIKTVMITGDNRLTAAAIAAEAGVDDFLAEATPEAKLALIRQYQAEGRLVAMTG
FT                   DGTNDAPALAQADVAVAMNSGTQAAKEAGNMVDLDSNPTKLIEVVHIGKQMLMTRGSLT
FT                   TFSIANDVAKYFAIIPAAFAATYPQLNALNIMRLHSPDSAILSAVIFNALIIVFLIPLA
FT                   LKGVSYKPLTASAMLRRNLWIYGLGGLLVPFIGIKVIDLLLTVCGLV"
     atgagtcgta aacaactggc gctattcgaa ccaacacttg tcgttcaggc gctgaaagaa        60
     gcggtgaaaa aattaaaccc gcaggcgcaa tggcgcaatc cggtgatgtt tatcgtctgg       120
     atcggcagtc tgctgaccac ctgtattagc atcgcgatgg caagcggtgc gatgcccggc       180
     aatgcgctgt ttagcgcggc cattagcggt tggctgtgga tcaccgtact gttcgctaat       240
     ttcgccgagg cgctggcaga aggccgcagt aaagcgcagg ccaacagtct gaaaggggtg       300
     aaaaaaactg cctttgcccg caagctgcgt gagccgaaat atggcgctgc ggaggacaaa       360
     gttcccgccg atcaactgcg taaaggcgat atcgtactgg tagaagctgg cgatattatc       420
     ccctgcgatg gtgaagtcat tgaagggggc gcatcggtcg atgaaagcgc catcaccggg       480
     gaatcggcac cggtgatccg tgaatccggc ggcgattttg cctccgtcac cggcggcacg       540
     cgtattcttt ctgactggct ggtgattgag tgtagcgtta accccggcga gacatttctg       600
     gatcggatga tcgcgatggt ggaaggcgca cagcgacgta aaacgccgaa cgagattgcc       660
     ctgaccatcc tgctgattgc cctgactatc gtctttttac tggcaaccgc cacgctgtgg       720
     ccgttttccg cgtggggcgg taatgcagtc agcgtaacgg tactggtggc gctgctggtc       780
     tgtctgatcc caaccactat tggcggcctg ttgtcagcga tcggcgtcgc cgggatgagc       840
     cggatgctgg gcgcgaatgt gattgccacc agcggacgtg cagttgaagc ggcaggtgac       900
     gttgacgttc tgctactgga taaaaccggc accatcacac tcggtaaccg tcaggcgtcg       960
     gagtttatcc ctgcgcaggg cgtggatgaa aaaacgctgg ctgacgccgc acaactggct      1020
     tcgctggctg atgaaacgcc ggaaggccgc agtattgtga tcctcgccaa gcaacgtttt      1080
     aacctgcgcg agcgcgatgt gcagtcgctc catgccacct ttgtaccgtt tactgcgcaa      1140
     agccggatga gcgggatcaa catcgacaac cgcatgatcc gtaaaggttc tgtcgatgcc      1200
     attcgccgcc atgttgaggc taacggcggt cacttccctg ccgatgttga tcaaaaagtc      1260
     gatcaggttg cgcgtcaggg ggccacgccg ctggtggtgg tggaaggttc ccgtgtgctg      1320
     ggcgttattg cgctgaaaga tatcgtcaaa ggcggtatta aagagcgctt cgcccagctg      1380
     cgcaaaatgg gcattaaaac ggtgatgatt accggcgata accgtctgac tgccgccgcc      1440
     attgctgcgg aagcgggcgt cgatgatttt ctcgccgaag cgacaccgga ggccaagctg      1500
     gcattgattc gtcagtatca ggcggaaggc cgtttggtgg cgatgaccgg cgacggcacc      1560
     aacgatgctc cggcgctggc gcaggcagat gtcgcggtgg cgatgaactc cggcacccag      1620
     gcggcgaaag aggcgggcaa tatggtcgat ctcgactcta acccgaccaa gttgatcgag      1680
     gtggtgcata ttggcaaaca gatgctgatg acccgtggct cgctgaccac cttcagcatt      1740
     gccaacgatg tggcgaaata cttcgccatt attccggcgg cgttcgcggc aacgtatccg      1800
     cagttaaatg cgctgaacat catgcgcctt cattcgcccg actccgccat tctcagtgcg      1860
     gtcattttca acgccttgat tatcgtcttt ttgattcctc tggcgttaaa aggcgtgagt      1920
     tataaaccgc ttaccgcttc tgccatgttg cgccgtaact tatggattta cggtctgggt      1980
     gggctgctgg tgccgtttat tggtatcaaa gtcattgatt tactgctgac cgtttgcggt      2040
     ctggtgtga                                                              2049
//

If you have problems or comments...

PBIL Back to PBIL home page