(data stored in ACNUC7421 zone)

EMBL: CP001509.KDPC

CP001509.KDPC        Location/Qualifiers
FT   CDS_pept        complement(684281..684853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpC"
FT                   /locus_tag="ECD_00653"
FT                   /product="potassium translocating ATPase, subunit C"
FT                   /EC_number="3.6.3.9"
FT                   /note="similar to b0696"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00653"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42529"
FT                   /protein_id="ACT42529.1"
FT                   /translation="MRGLRPALSTFIFLLLITGGVYPLLTTVLGQWWFPWQANGSLIRE
FT                   GDTVRGSALIGQNFTGNGYFQGRPSATAEMPYNPQASGGSNLAVSNPELDKQIAARVAA
FT                   LRAANPDASTNVPVELVTASASGLDNNITPQAAVWQIPRVAKARNLSVEQLTQLIAKYS
FT                   QQPLVKYIGQPVVNIVELNLALDKLDE"
     atgcgtggct tacgtccggc attatcgaca tttatctttc tgttattgat tactggcggc        60
     gtttacccgc tgctgaccac cgtgctgggg caatggtggt ttccctggca ggccaacggt       120
     tcgttgattc gtgaaggtga tacggtgcgg ggttcggcat taatcgggca gaattttacc       180
     ggcaacggct attttcaggg tcgcccgtcg gcaacggcag aaatgcccta taatccacag       240
     gcttctggcg ggagcaatct ggcggtcagt aaccctgagc tggataaaca aatagccgca       300
     cgcgttgctg cattacgggc cgctaacccg gatgccagta cgaacgttcc ggttgaactg       360
     gtgacggcat cggcaagcgg gctggacaat aatatcaccc cgcaagcggc ggtctggcaa       420
     atcccacgcg tggcgaaagc gcgtaatctc agcgttgaac agctcacgca actgatcgca       480
     aaatacagcc aacaaccgct ggtgaaatat atcggccagc cggtcgtcaa cattgttgaa       540
     ctcaatctgg cgctggataa acttgatgaa taa                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page