(data stored in ACNUC7421 zone)

EMBL: CP001509.KDPD

CP001509.KDPD        Location/Qualifiers
FT   CDS_pept        complement(681604..684288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpD"
FT                   /locus_tag="ECD_00652"
FT                   /product="fused sensory histidine kinase in two-component
FT                   regulatory system with KdpE: signal sensing protein"
FT                   /EC_number="2.7.1.-"
FT                   /note="similar to b0695"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00652"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42528"
FT                   /protein_id="ACT42528.2"
FT                   /translation="MNNEPLRPDPDRLLEQTAAPHRGKLKVFFGACAGVGKTWAMLAEA
FT                   QRLRAQGLDIVVGVVETHGRKDTAAMLEGLAVLPPKRQAYRGRHISEFDLDAALARRPA
FT                   LILMDELAHSNAPGSRHPKRWQDIEELLEAGIDVFTTVNVQHLESLNDVVSGVTGIQVR
FT                   ETVPDPFFDAADDVVLVDLPPDDLRQRLKEGKVYIAGQAERAIEHFFRKGNLIALRELA
FT                   LRRTADRVDEQMRAWRGHPGEEKVWHTRDAILLCIGHNTGSEKLVRAAARLASRLGSVW
FT                   HAVYVETPALHRLPEKKRRAILSALRLAQELGAETATLSDPAEEKAVVRYAREHNLGKI
FT                   ILGRPASRRWWRRETFADRLARIAPDLDQVLVALDEPPARTINNAPDSRSFKDKWRVQI
FT                   QGCVVAAALCAVITLIAMQWLMAFDAANLVMLYLLGVVVVALFYGRWPSVVATVINVVS
FT                   FDLFFIAPRGTLAVSDVQYLLTFAVMLTVGLVIGNLTAGVRYQARVARYREQRTRHLYE
FT                   MSKALAVGRSPQDIAATSEQFIASTFHARSQVLLPDDNGKLQPLTHPQGMTPWDDAIAQ
FT                   WSFDKGLPAGAGTDTLPGVPYQILPLKSGEKTYGLVVVEPGNLRQLMIPEQQRLLETFT
FT                   LLVANALERLTLTASEEQARMASEREQIRNALLAALSHDLRTPLTVLFGQAEILTLDLA
FT                   SEGSPHARQASEIRQHVLNTTRLVNNLLDMARIQSGGFNLKKEWLTLEEVVGSALQMLE
FT                   PGLSSPINLSLPEPLTLIHVDGPLFERVLINLLENAVKYAGAQAEIGIDAHVEGENLQL
FT                   DVWDNGPGLPPGQEQTIFDKFARGNKESAVPGVGLGLAICRAIVDVHGGTITAFNRPEG
FT                   GACFRVTLPQQTAPELEEFHEDM"
     atgaataacg aacccttacg tcccgacccc gatcgtctgc tggaacaaac tgccgcgccg        60
     catcggggga agctgaaagt tttcttcggt gcctgtgcag gcgtcgggaa gacctgggcg       120
     atgctggcag aagcccagcg actgcgggcg caagggctgg atattgtggt tggcgtggta       180
     gaaacccatg ggcggaaaga taccgccgcc atgcttgaag ggctggctgt tctgccgccc       240
     aaacgccagg cgtaccgtgg gcggcatatc agcgagtttg atctcgatgc cgccctcgcc       300
     cgccgtccgg cgctgatctt aatggacgaa ctggcgcaca gtaatgcgcc aggttctcgt       360
     catcctaaac gctggcagga tatcgaagaa ctgctggaag ctggcattga tgttttcaca       420
     accgtcaacg ttcagcatct ggaaagtctg aatgatgtgg tcagcggcgt caccggaatt       480
     caggtacggg aaaccgtgcc cgatcctttt ttcgatgccg ccgacgacgt agtgctggtg       540
     gacttgcccc cggacgatct gcgccagcgg ctgaaagaag gcaaagtcta tattgccggg       600
     caggcggagc gcgccattga acattttttc cgcaaaggca atctgatcgc cctgcgtgaa       660
     ctggcactgc gccgtactgc cgatcgcgta gatgagcaaa tgcgcgcctg gcgggggcat       720
     cctggtgaag agaaagtgtg gcacacgcgc gacgcgatcc ttttatgtat cgggcataac       780
     accggcagtg agaaactggt ccgcgcggcg gcgcggttgg cctcgcgcct gggtagcgtc       840
     tggcacgcgg tgtatgttga aacccctgcc ctgcatcgct taccggaaaa aaaacgtcgg       900
     gcaattctca gcgccttacg tctggcgcag gaactgggcg cggagacggc aacactttct       960
     gatccagcag aagagaaagc ggtagtgcgt tatgcccgtg aacataatct cggcaagatt      1020
     attctcggtc gcccagcctc gcgccgctgg tggcgtcggg aaacgtttgc tgaccgactg      1080
     gcgcgcatcg cccccgatct cgatcaggtg ctggtcgcgc ttgatgaacc acccgcccgc      1140
     acgattaaca acgcgccgga tagccgctct tttaaagaca agtggcgggt acagattcag      1200
     ggatgcgtgg ttgccgccgc gttatgcgcc gttatcacct taattgccat gcagtggctg      1260
     atggcgtttg atgccgccaa cctggtgatg ctgtatctgc ttggcgtggt ggtagtggcg      1320
     ctattttatg gacgctggcc ttcggtggtt gctaccgtca ttaatgtggt gagtttcgat      1380
     ctctttttta tcgccccacg cggcacgctc gccgtctctg atgtgcaata tctgctgacc      1440
     ttcgcggtga tgttaaccgt cgggctggtg atcgggaacc ttactgctgg cgtgcgttat      1500
     caggcgcggg tagcccgcta ccgcgagcaa cgcacacggc acttatatga aatgtcgaaa      1560
     gctctggcgg tgggccgcag tccgcaggac atcgccgcca ccagcgaaca atttattgcc      1620
     tccacgtttc atgcccgcag tcaggtgttg ttgcccgatg acaacggtaa attgcagccg      1680
     ttaacacatc cgcaaggaat gacgccatgg gacgatgcca tcgcgcagtg gagttttgat      1740
     aaaggcctgc ctgcgggtgc gggcaccgac acgttacccg gcgtgccgta ccagattttg      1800
     ccgctaaaaa gcggcgagaa aacctacgga ctggtggtgg tggaaccggg gaatctgcgc      1860
     cagttgatga tcccggagca gcagcgcctg ctggagacat ttacgctgtt agtcgccaat      1920
     gcccttgagc ggctgacact gaccgccagc gaagaacagg cgcggatggc aagcgaacgt      1980
     gaacagatcc gcaacgccct gctggcggcg ctttcgcatg atttacgcac gccgcttacg      2040
     gtgctgtttg gtcaggcaga aatcttaacg ctcgatctgg caagcgaagg atcgccccac      2100
     gcccgccagg ccagcgagat tcgtcagcat gtgctgaaca ctacccgact ggtgaataat      2160
     ctactggata tggcgcgaat tcagtccggc ggctttaatt tgaagaaaga gtggttaacg      2220
     ctggaagaag tagtcggcag cgcgctgcaa atgctggaac cgggtttatc gtcgcccatc      2280
     aatctttctc tgccagaacc gctgacctta atccacgttg acgggccact ctttgaacgg      2340
     gtgctgatta atctgctgga gaacgcggtg aaatatgcgg gtgcgcaggc cgaaattggt      2400
     atcgatgccc acgttgaggg cgaaaatcta caactggatg tctgggataa cggccccggt      2460
     cttccgccag gccaggagca gacgatattt gataagtttg ctcgcgggaa taaagagtcg      2520
     gcagtaccgg gggtagggct tggactggca atttgtcggg cgatagtgga tgtacacggg      2580
     ggcactatta ccgcgttcaa ccgaccggaa ggtggtgcct gttttcgtgt tacacttccc      2640
     cagcaaactg cccctgaact tgaagaattt catgaggata tgtga                      2685
//

If you have problems or comments...

PBIL Back to PBIL home page