(data stored in ACNUC7421 zone)

EMBL: CP001509.LEUD

CP001509.LEUD        Location/Qualifiers
FT   CDS_pept        complement(81653..82258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="ECD_00073"
FT                   /product="3-isopropylmalate dehydratase small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="similar to b0071"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00073"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41974"
FT                   /protein_id="ACT41974.1"
FT                   /translation="MAEKFIKHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFN
FT                   DWRFLDEKGQQPNPDFVLNFPQYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAP
FT                   SFADIFYGNSFNNQLLPVKLSDAEVDELFALVKANPGIHFDVDLEAQEVKAGEKTYRFT
FT                   IDAFRRHCMMNGLDSIGLTLQHDDAIAAYEAKQPAFMN"
     atggcagaga aatttatcaa acacacaggc ctggtggttc cgctggatgc cgccaatgtc        60
     gataccgatg caatcatccc gaaacagttt ttgcagaaag tgacccgtac gggttttggc       120
     gcgcatctgt ttaacgactg gcgttttctg gatgaaaaag gccaacagcc aaacccggac       180
     ttcgtgctga acttcccgca gtatcagggc gcttccattt tgctggcacg agaaaacttc       240
     ggctgtggct cttcgcgtga gcacgcgccc tgggcattga ccgactacgg ttttaaagtg       300
     gtgattgcgc cgagttttgc tgacatcttc tacggcaata gctttaacaa ccagctgctg       360
     ccggtgaaat taagcgatgc agaagtggac gaactgtttg cgctggtgaa agccaatccg       420
     gggatccatt tcgacgtgga tctggaagcg caagaggtga aagcgggaga gaaaacctat       480
     cgctttacca tcgatgcctt ccgccgccac tgcatgatga acggtctgga cagtattggg       540
     cttaccttgc agcacgacga cgccattgcc gcttatgaag caaaacaacc tgcgtttatg       600
     aattaa                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page