(data stored in ACNUC7421 zone)

EMBL: CP001509.LPD

CP001509.LPD         Location/Qualifiers
FT   CDS_pept        130717..132141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpd"
FT                   /locus_tag="ECD_00115"
FT                   /product="dihydrolipoyl dehydrogenase; E3 component of
FT                   pyruvate and 2-oxoglutarate dehydrogenases complexes;
FT                   glycine cleavage system L protein; dihydrolipoamide
FT                   dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="similar to b0116"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00115"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42016"
FT                   /protein_id="ACT42016.1"
FT                   /translation="MSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYNTLGGVC
FT                   LNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPKTDIDKIRTWKEKVINQLTGGLAGM
FT                   AKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAIIAAGSRPIQLPFIPHEDPRIW
FT                   DSTDALELKEVPERLLVMGGGIIGLEMGTVYHALGSQIDVVEMFDQVIPAADKDIVKVF
FT                   TKRISKKFNLMLETKVTAVEAKEDGIYVTMEGKKAPAEPQRYDAVLVAIGRVPNGKNLD
FT                   AGKAGVEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAAEVIAGKKH
FT                   YFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKL
FT                   IFDKESHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEV
FT                   FEGSITDLPNPKAKKK"
     atgagtactg aaatcaaaac tcaggtcgtg gtacttgggg caggccccgc aggttactcc        60
     gctgccttcc gttgcgctga tttaggtctg gaaaccgtaa tcgtagaacg ttacaacacc       120
     cttggcggtg tttgcctgaa cgtcggctgt atcccttcta aagcactgct gcacgtagca       180
     aaagttatcg aagaagccaa agcgctggct gaacacggta tcgtcttcgg cgaaccgaaa       240
     accgatatcg acaagattcg tacctggaaa gagaaagtga tcaatcagct gaccggtggt       300
     ctggctggta tggcgaaagg ccgcaaagtc aaagtggtca acggtctggg taaattcacc       360
     ggggctaaca ccctggaagt tgaaggtgag aacggcaaaa ccgtgatcaa cttcgacaac       420
     gcgatcattg cagcgggttc tcgcccgatc caactgccgt ttattccgca tgaagatccg       480
     cgtatctggg actccactga cgcgctggaa ctgaaagaag taccagaacg cctgctggta       540
     atgggtggcg gtatcatcgg tctggaaatg ggcaccgttt accacgcgct gggttcacag       600
     attgacgtgg ttgaaatgtt cgaccaggtt atcccggcag ctgacaaaga catcgttaaa       660
     gtcttcacca agcgtatcag caagaaattc aacctgatgc tggaaaccaa agttaccgcc       720
     gttgaagcga aagaagacgg catttatgtg acgatggaag gcaaaaaagc acccgctgaa       780
     ccgcagcgtt acgacgccgt gctggtagcg attggtcgtg tgccgaacgg taaaaacctc       840
     gacgcaggca aagcaggcgt ggaagttgac gaccgtggtt tcatccgcgt tgacaaacag       900
     ctgcgtacca acgtaccgca catctttgct atcggcgata tcgtcggtca accgatgctg       960
     gcacacaaag gtgttcacga aggtcacgtt gccgctgaag ttatcgccgg taagaaacac      1020
     tacttcgatc cgaaagttat cccgtccatc gcctataccg aaccagaagt tgcatgggtg      1080
     ggtctgactg agaaagaagc gaaagagaaa ggcatcagct atgaaaccgc caccttcccg      1140
     tgggctgctt ctggtcgtgc tatcgcttcc gactgcgcag acggtatgac caagctgatt      1200
     ttcgacaaag aatctcaccg tgtgatcggt ggtgcgattg tcggtactaa cggcggcgag      1260
     ctgctgggtg aaatcggcct ggcaatcgaa atgggttgtg atgctgaaga catcgcactg      1320
     accatccacg cgcacccgac tctgcacgag tctgtgggcc tggcggcaga agtgttcgaa      1380
     ggtagcatta ccgacctgcc gaacccgaaa gcgaagaaga agtaa                      1425
//

If you have problems or comments...

PBIL Back to PBIL home page