(data stored in ACNUC7421 zone)

EMBL: CP001509.MAK

CP001509.MAK         Location/Qualifiers
FT   CDS_pept        375546..376454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mak"
FT                   /locus_tag="ECD_00343"
FT                   /product="manno(fructo)kinase"
FT                   /note="similar to b0394"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00343"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42242"
FT                   /protein_id="ACT42242.1"
FT                   /translation="MRIGIDLGGTKTEVIALGDAGEQLYRHRLPTPRDDYRQTIETIAT
FT                   LVDMAEQATGQRGTVGMGIPGSISPYTGVVKNANSTWLNGQPFDKDLSARLQREVRLAN
FT                   DANCLAVSEAVDGAAAGAQTVFAVIIGTGCGAGVAFNGRAHIGGNGTAGEWGHNPLPWM
FT                   DEDELRYREEVPCYCGKQGCIETFISGTGFAMDYRRLSGHALKGSEIIRLVEESDPVAE
FT                   LALRRYELRLAKSLAHVVNILDPDVIVLGGGMSNVDRLYQTVGQLIKQFVFGGECETPV
FT                   RKAKHGDSSGVRGAAWLWPQE"
     gtgcgtatag gtatcgattt aggcggcacc aaaactgaag tgattgcact gggcgatgca        60
     ggggagcagt tgtaccgcca tcgtctgccc acgccgcgtg atgattaccg gcagactatt       120
     gaaacgatcg ccacgttggt tgatatggcg gagcaggcga cggggcagcg cggaacggta       180
     ggtatgggca ttcctggctc aatttcgcct tacaccggtg tggtgaagaa tgccaattca       240
     acctggctca acggtcagcc attcgataaa gacttaagcg cgaggttgca gcgggaagtg       300
     cggctggcaa atgacgctaa ctgtctggcg gtttcagaag cagtagatgg cgcggcagcg       360
     ggagcgcaga cggtatttgc cgtgattatc ggcacgggat gcggcgcggg cgtggcattc       420
     aatgggcggg cgcatatcgg cggcaatggc acggcaggtg agtggggaca caatccgcta       480
     ccgtggatgg acgaagacga actgcgttat cgcgaggaag tcccttgtta ttgcggtaaa       540
     caaggttgta ttgaaacctt tatttcgggc acgggattcg cgatggatta tcgtcgtttg       600
     agcggacatg cgctgaaagg cagtgaaatt atccgcctgg ttgaagaaag cgatccggta       660
     gcggaactgg cattgcgtcg ctacgagctg cggctggcaa aatcgctggc acatgtcgtg       720
     aatattctcg atccggatgt gattgtcctg gggggcggga tgagcaatgt agaccgttta       780
     tatcaaacgg ttgggcagtt gattaaacaa tttgtcttcg gcggcgaatg tgaaacgccg       840
     gtgcgtaagg cgaagcacgg tgattccagc ggcgtacgcg gcgctgcgtg gttatggcca       900
     caagagtaa                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page