(data stored in ACNUC7421 zone)

EMBL: CP001509.METN

CP001509.METN        Location/Qualifiers
FT   CDS_pept        complement(224455..225486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metN"
FT                   /locus_tag="ECD_00198"
FT                   /product="DL-methionine transporter subunit"
FT                   /note="similar to b0199"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00198"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42099"
FT                   /protein_id="ACT42099.1"
FT                   /translation="MIKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKS
FT                   TLIRCVNLLERPTEGSVLVDGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVA
FT                   LPLELDNTPKDEIKRRVTELLSLVGLGDKHDSYPSNLSGGQKQRVAIARALASNPKVLL
FT                   CDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQ
FT                   DTVSEVFSHPKTPLAQKFIQSTLHLDIPEDYQERLQAEPFTDCVPMLRLEFTGQSVDAP
FT                   LLSETARRFNVNNNIISAQMDYAGGVKFGIMLTEMHGTQQDTQAAIAWLQEHHVKVEVL
FT                   GYV"
     atgataaaac tttcgaatat caccaaagtg ttccaccagg gcacccgcac catccaggcg        60
     ttgaacaacg tcagcctgca tgtgccagct ggacaaattt atggcgttat cggtgcctca       120
     ggcgcgggta agagtacgct tatacgttgt gtaaacctgc tggagcgccc aaccgagggt       180
     agcgtgctgg tcgatggcca ggagctgacc acgctgtcag aatctgagtt gaccaaagct       240
     cgccgccaga ttggtatgat tttccagcat tttaacctgc tctcttcgcg tactgttttt       300
     ggcaacgtgg ctctgccgct ggagctggac aacacaccga aagacgagat caaacgtcgc       360
     gtgacggaat tgctgtcatt ggttggtctt ggcgataagc atgatagcta cccgtcgaat       420
     ctttccggtg ggcagaaaca acgtgtggcg attgcccgtg cattagccag caatcccaaa       480
     gtattgctgt gtgatgaagc caccagcgcg ctggacccgg caacgacacg ttctattctc       540
     gaactgctga aagacatcaa ccgccgtctg ggtttgacga ttctgttgat cacccacgaa       600
     atggacgttg tgaagcgtat ttgtgattgc gtggcggtca tcagcaacgg cgaactgatc       660
     gagcaggaca cggtaagtga agtgttctca catccgaaaa cgccgctggc gcagaagttt       720
     attcagtcta ccctgcatct ggatatcccg gaagattacc aggaacgtct gcaagcggag       780
     ccattcactg actgcgtgcc gatgttgcgt ctggagttta ccggtcaatc ggtcgatgcc       840
     ccactgcttt ctgaaaccgc gcgtcgtttc aacgtcaaca acaacattat tagcgcgcag       900
     atggattacg ccggtggcgt taagttcggc atcatgctga ctgaaatgca cggcacacaa       960
     caagatacgc aagccgccat tgcctggctg caggaacacc atgtaaaagt agaggtactg      1020
     ggttatgtct ga                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page