(data stored in ACNUC7421 zone)

EMBL: CP001509.MOAA

CP001509.MOAA        Location/Qualifiers
FT   CDS_pept        801037..802026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaA"
FT                   /locus_tag="ECD_00748"
FT                   /product="molybdopterin biosynthesis protein A"
FT                   /note="similar to b0781"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00748"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42649"
FT                   /protein_id="ACT42649.1"
FT                   /translation="MASQLTDAFARKFYYLRLSITDVCNFRCTYCLPDGYKPSGVTNKG
FT                   FLTVDEIRRVTRAFASLGTEKVRLTGGEPSLRRDFTDIIAAVRENDAIRQIAVTTNGYR
FT                   LERDVANWRDAGLTGINVSVDSLDARQFHAITGQDKFNQVMAGIDAAFEAGFEKVKVNT
FT                   VLMRDVNHHQLDTFLNWIQHRPIQLRFIELMETGEGSELFRKHHISGQVLRDELLRRGW
FT                   IHQLRQRSDGPAQVFCHPDYAGEIGLIMPYEKDFCATCNRLRVSSIGKLHLCLFGEGGV
FT                   NLRDLLEDDTQQQALEARISAALREKKQTHFLHQNNTGITQNLSYIGG"
     atggcttcac aactgactga tgcatttgcg cgtaagtttt actacttgcg cctgtcgatt        60
     accgatgtgt gtaactttcg ttgcacctac tgcctgccgg atgggtacaa gccgagcggc       120
     gtcaccaata aaggctttct aaccgtcgat gaaattcgcc gggttacgcg cgccttcgcc       180
     agtctgggca ccgaaaaagt gcgcctgaca ggcggtgagc cgtctttacg ccgcgacttt       240
     accgatatca tcgccgctgt gcgagaaaat gacgctatcc gccagattgc ggtcaccacc       300
     aatggttacc gtctggaacg cgatgtggcg aactggcgcg atgcgggact tactggcatc       360
     aacgtcagcg ttgatagtct ggacgcccgc cagtttcacg ctattaccgg gcaggataaa       420
     ttcaaccagg tcatggcagg gatcgatgct gcatttgagg ccggttttga gaaggtcaaa       480
     gtcaataccg tgctgatgcg tgatgtgaat catcatcagc tcgacacttt tctgaactgg       540
     atccagcatc gtcccatcca gctgcgtttc atcgaactga tggaaacggg cgagggcagc       600
     gagctcttcc gtaagcatca catctctggt caggttctgc gtgacgagtt actgcgtcgc       660
     ggctggatcc accaattacg tcaacgcagc gacggccccg cgcaagtctt ttgtcatccg       720
     gattacgccg gagagattgg ccttatcatg ccgtatgaaa aagacttctg cgccacttgc       780
     aaccgcctgc gcgtttcctc cattggtaaa ctccatctct gcctgtttgg tgaaggcggc       840
     gttaacctgc gcgatctgct ggaagacgat acccagcaac aggcgctgga agcgcgtatt       900
     tcagcggcgc tgcgggagaa gaaacagacc catttcctgc atcaaaacaa caccggtatt       960
     acgcaaaact tatcgtacat tggcggctaa                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page