(data stored in ACNUC7421 zone)

EMBL: CP001509.MOAC

CP001509.MOAC        Location/Qualifiers
FT   CDS_pept        802563..803048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaC"
FT                   /locus_tag="ECD_00750"
FT                   /product="molybdopterin biosynthesis, protein C"
FT                   /note="similar to b0783"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00750"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42651"
FT                   /protein_id="ACT42651.1"
FT                   /translation="MSQLTHINAAGEAHMVDVSAKAETVREARAEAFVTMRSETLAMII
FT                   DGRHHKGDVFATARIAGIQAAKRTWDLIPLCHPLMLSKVEVNLQAEPEHNRVRIETLCR
FT                   LTGKTGVEMEALTAASVAALTIYDMCKAVQKDMVIGPVRLLAKSGGKSGDFKVEADD"
     atgtcgcaac tgacccatat caacgccgct ggcgaagcgc acatggtgga tgtctccgcc        60
     aaagcggaaa ccgtgcgtga agcgcgggcg gaagcctttg tcaccatgcg cagcgagacg       120
     ctggcgatga ttattgatgg tcgccaccac aaaggcgacg tatttgccac tgcgcgtatt       180
     gccggtattc aggcggcaaa acgcacctgg gatctgatcc cgctgtgtca tccgctgatg       240
     ctcagcaaag ttgaagtcaa tttacaggcc gagccggagc acaatcgggt gcgtatagaa       300
     accttatgcc gcctgaccgg gaaaaccggt gtcgaaatgg aagcgttaac cgcggcctcc       360
     gtggcggcgc tgaccattta tgacatgtgc aaagcggtgc aaaaagatat ggtgattggt       420
     ccggtacgtt tgctggcgaa gagcggcggc aagtcaggtg actttaaggt ggaagcggat       480
     gattaa                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page