(data stored in ACNUC7421 zone)

EMBL: CP001509.MOAD

CP001509.MOAD        Location/Qualifiers
FT   CDS_pept        803041..803286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaD"
FT                   /locus_tag="ECD_00751"
FT                   /product="molybdopterin synthase, small subunit"
FT                   /note="similar to b0784"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00751"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42652"
FT                   /protein_id="ACT42652.1"
FT                   /translation="MIKVLFFAQVRELVGTDATEVAADFPTVEALRQHLAAQSDRWALA
FT                   LEDGKLLAAVNQTLVSFDHPLTDGDEVAFFPPVTGG"
     atgattaaag ttcttttttt cgcccaggtg cgcgagttgg tgggaacaga tgcaaccgaa        60
     gtggctgcgg atttcccaac cgttgaagcg ttacgccaac atctggctgc gcagagcgat       120
     cgctgggcgc tggcgctgga agatggcaaa ttgctggctg ccgtcaacca gacgctggtg       180
     agttttgacc atccgctgac tgacggcgac gaagtggctt tcttcccgcc ggtaaccgga       240
     ggttaa                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page