(data stored in ACNUC7421 zone)

EMBL: CP001509.MOAE

CP001509.MOAE        Location/Qualifiers
FT   CDS_pept        803288..803740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaE"
FT                   /locus_tag="ECD_00752"
FT                   /product="molybdopterin synthase, large subunit"
FT                   /note="similar to b0785"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00752"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42653"
FT                   /protein_id="ACT42653.1"
FT                   /translation="MAETKIVVGPQPFSVGEEYPWLAERDEDGAVVTFTGKVRNHNLGD
FT                   SVKALTLEHYPGMTEKALAEIVDEARNRWPLGRVTVIHRIGELWPGDEIVFVGVTSEHR
FT                   SSAFEAGQFIMDYLKTRAPFWKREATPEGDRWVEARESDQQAAKRW"
     atggcagaaa ccaaaattgt tgtcggcccg cagccattca gcgtaggaga agagtatccg        60
     tggctggcgg agcgtgatga agacggtgcg gtagtcacct ttaccggtaa ggtgcgcaac       120
     cataaccttg gcgacagcgt caaagcatta accctcgaac actatccggg gatgactgaa       180
     aaagcactgg cagaaattgt cgatgaagcg cgtaaccgct ggccgctggg gcgcgtcacg       240
     gtgattcacc gcatcgggga attatggccg ggcgatgaaa tcgtttttgt cggtgtcacc       300
     agtgagcacc gcagcagtgc gtttgaagcc gggcagttta ttatggatta tctcaaaacc       360
     cgcgcaccgt tctggaagcg cgaagccacg ccggaaggcg accgctgggt tgaagctcgg       420
     gagagcgatc agcaggcggc aaaacgctgg tag                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page