(data stored in ACNUC7421 zone)

EMBL: CP001509.MOKC

CP001509.MOKC        Location/Qualifiers
FT   CDS_pept        complement(16749..16958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mokC"
FT                   /locus_tag="ECD_00017"
FT                   /product="regulatory protein for HokC"
FT                   /note="similar to b0018; overlaps CDS of hokC"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00017"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41919"
FT                   /protein_id="ACT41919.1"
FT                   /translation="MLNTCRVPLTDRKVKEKRAMKQHKAMIVALIVICITAVVAALVTR
FT                   KDLCEVHIRTGQTEVAVFTAYESE"
     atgctgaaca catgtagagt gcctcttact gaccgtaagg tcaaggagaa gagagcaatg        60
     aagcagcata aggcgatgat tgtcgccctg atcgtcatct gtatcaccgc cgtagtggcg       120
     gcgctggtaa cgagaaaaga cctctgtgag gttcacatcc gaactggcca gacggaggtt       180
     gctgttttca cggcttacga atccgagtaa                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page