(data stored in ACNUC7421 zone)

EMBL: CP001509.MSCK

CP001509.MSCK        Location/Qualifiers
FT   CDS_pept        455582..458944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscK"
FT                   /locus_tag="ECD_00416"
FT                   /product="mechanosensitive channel protein, intermediate
FT                   conductance, K+ regulated"
FT                   /note="similar to b0465"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00416"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42315"
FT                   /protein_id="ACT42315.1"
FT                   /translation="MTMFQYYKRSRHFVFSAFIAFVFVLLCQNTAFARASSNGDLPTKA
FT                   DLQAQLDSLNKQKDLSAQDKLVQQDLTDTLATLDKIDRIKEETVQLRQKVAEAPEKMRQ
FT                   ATAALTALSDVDNDEETRKILSTLSLRQLETRVAQALDDLQNAQNDLASYNSQLVSLQT
FT                   QPERVQNAMYNASQQLQQIRSRLDGTDVGETALRPSQKVLMQAQQALLNAEIDQQRKSL
FT                   EGNTVLQDTLQKQRDYVTANSARLEHQLQLLQEAVNSKRLTLTEKTAQEAVSPDEAARI
FT                   QANPLVKQELEINQQLSQRLITATENGNQLMQQNIKVKNWLERALQSERNIKEQIAVLK
FT                   GSLLLSRILYQQQQTLPSADELENMTNRIADLRLEQFEVNQQRDALFQSDAFVNKLEEG
FT                   HTNEVNSEVHDALLQVVDMRRELLDQLNKQLGNQLMMAINLQINQQQLMSVSKNLKSIL
FT                   TQQIFWVNSNRPMDWDWIKAFPQSLKDEFKSMKITVNWQKAWPAVFIAFLAGLPLLLIA
FT                   GLIHWRLGWLKAYQQKLASAVGSLRNDSQLNTPKAILIDLIRALPVCLIILAVGLILLT
FT                   MQLNISELLWSFSKKLAIFWLVFGLCWKVLEKNGVAVRHFGMPEQQTSHWRRQIVRISL
FT                   ALLPIHFWSVVAELSPLHLMDDVLGQAMIFFNLLLIAFLVWPMCRESWRDKESHTMRLV
FT                   TITVLSIIPIALMVLTATGYFYTTLRLAGRWIETVYLVIIWNLLYQTVLRGLSVAARRI
FT                   AWRRALARRQNLVKEGAEGAEPPEEPTIALEQVNQQTLRITMLLMFALFGVMFWAIWSD
FT                   LITVFSYLDSITLWHYNGTEAGAAVVKNVTMGSLLFAIIASMVAWALIRNLPGLLEVLV
FT                   LSRLNMRQGASYAITTILNYIIIAVGAMTVFGSLGVSWDKLQWLAAALSVGLGFGLQEI
FT                   FGNFVSGLIILFERPVRIGDTVTIGSFSGTVSKIRIRATTITDFDRKEVIIPNKAFVTE
FT                   RLINWSLTDTTTRLVIRLGVAYGSDLEKVRKVLLKAATEHPRVMHEPMPEVFFTAFGAS
FT                   TLDHELRLYVRELRDRSRTVDELNRTIDQLCRENDINIAFNQLEVHLHNEKGDEVTEVK
FT                   RDYKGDDPTPAVG"
     atgactatgt tccagtatta caaacgatca cggcattttg ttttttcagc atttattgct        60
     tttgtttttg tcttgttatg ccagaacacg gcgtttgcgc gggcgtcatc gaatggtgat       120
     ctgccgacaa aagcggacct gcaggcgcaa cttgactcac taaataaaca aaaagatctt       180
     tctgctcagg acaaactggt gcagcaggat ctgacagata cattagccac cctcgataaa       240
     atcgatcgca taaaagaaga gacagttcag ctacggcaaa aagtcgctga agcgccggaa       300
     aaaatgcgcc aggcgaccgc ggcgttaaca gcacttagcg atgtcgataa cgacgaagaa       360
     acgcgcaaaa ttctgagcac gctgtcgttg cgccagctgg aaactcgcgt tgcccaggcg       420
     ctggacgatt tgcaaaacgc acaaaacgat ctggcgtctt ataacagcca gctggtttcg       480
     ttacagacgc agcccgaacg cgtgcaaaat gcgatgtata acgcttcgca gcagctgcaa       540
     caaattcgca gtcgtctgga tgggactgat gtcggcgaga cagccttacg tcccagccag       600
     aaagtgttaa tgcaggccca gcaggcgttg ctgaatgcgg agattgacca gcagcgtaaa       660
     agcctggaag ggaacaccgt cttgcaggat accttgcaaa agcaacgtga ttacgtgacg       720
     gcgaacagcg ctcgtctgga gcaccagtta caactgttgc aagaagcggt aaacagcaag       780
     cgcctgactt taaccgaaaa aacggcgcag gaagccgtct ccccggatga agccgcgcgt       840
     attcaggcta atccgctggt gaagcaggaa ctggaaatta accagcagtt aagtcagcgt       900
     ctgattaccg cgactgaaaa cggtaatcag ttgatgcagc aaaacattaa agtcaaaaac       960
     tggctggagc gggcgctgca atcggaacgc aatattaaag agcagattgc cgtcctgaag      1020
     ggcagcctgc tgttgtctcg tatcctttac cagcaacaac aaacgctgcc ctcggcggat      1080
     gaactggaaa acatgaccaa ccgcatcgcg gatttgcgtc tcgaacagtt tgaagttaac      1140
     cagcagcgtg atgcactctt ccagagcgat gcgttcgtca acaaactgga agaaggtcac      1200
     accaacgaag tcaacagcga agttcacgat gcgttattgc aagtggttga tatgcgtcgc      1260
     gaattgctgg atcaactcaa caaacagttg ggtaaccagc tgatgatggc cattaacctg      1320
     caaatcaacc agcagcagtt aatgagtgtg tcgaaaaacc tgaaatccat cctgactcag      1380
     caaatctttt gggtgaacag taaccgtcca atggactggg actggatcaa agcgttcccg      1440
     caaagcctga aagatgaatt taagtcgatg aaaatcacgg tgaactggca aaaagcctgg      1500
     cccgccgttt ttatcgcttt cctcgctggt ttgccgctgc tgttgattgc cgggctgatc      1560
     cactggcgtc tggggtggct gaaagcgtat caacaaaaac tggcttccgc tgtgggttcc      1620
     ctgcgtaacg acagccagct caacacacca aaagcgatcc ttatcgacct gatccgtgcg      1680
     ctgccggtgt gcctgattat tctcgcggtt ggcctgattc tgttgaccat gcagctcaac      1740
     atcagcgaac tgctatggtc gttcagcaaa aaactggcga tattctggct ggtgtttggc      1800
     ctgtgctgga aggtactgga gaaaaacggc gttgccgtac gtcacttcgg catgccggaa      1860
     cagcagacca gccactggcg tcggcaaatt gtccgcatca gtctcgcatt gctgcctatc      1920
     catttctggt ctgtggtggc agaactttcc ccgctgcatc tgatggatga tgtgctgggg      1980
     caagcgatga ttttcttcaa cctgctgctg attgctttcc tggtatggcc gatgtgccgc      2040
     gaaagctggc gtgataaaga gtcgcacacc atgcgactgg tcaccattac cgtgctgtcg      2100
     ataatcccga ttgcgctgat ggtgctgact gctacaggct acttctacac tacgctgcgt      2160
     ctggcaggac gctggattga aaccgtttat ctggtgatca tctggaacct gctgtaccag      2220
     acggtactgc gtggcttaag cgtagcggcg cggcgtatcg cctggcgtcg tgcgctggcg      2280
     cgtcggcaga atctggtgaa agagggcgca gaaggtgctg aaccgccgga agaacccacc      2340
     attgcactgg agcaagttaa ccagcagacg ctgcgtatta ccatgttgct gatgtttgcg      2400
     ctgttcggtg tcatgttctg ggcaatttgg tccgatttga tcaccgtgtt cagctatctc      2460
     gacagcatca cgctctggca ttacaacggc actgaagctg gcgctgcggt ggtgaaaaac      2520
     gtcaccatgg gcagtctgtt gtttgcgatt atcgcctcaa tggtggcctg ggcgttgatt      2580
     cgcaacctgc ctggtttact ggaagtgctg gtgctctcgc gactgaatat gcgccagggc      2640
     gcgtcgtatg ccattactac catccttaac tacatcatta ttgctgttgg tgcgatgacg      2700
     gtgttcggat cgctgggcgt ctcttgggat aaactccagt ggctggccgc agcattatcc      2760
     gtaggtcttg gttttggttt acaagaaatt ttcggtaact tcgtctccgg tttgatcatt      2820
     ctattcgaac gtccggtgcg tattggcgat acggtaacca ttggtagctt ctcggggacg      2880
     gtaagtaaga tccgtattcg tgcgacaacg attaccgatt tcgatcgcaa agaagtgatc      2940
     atcccgaaca aagcgtttgt taccgagcgt ctgatcaact ggtcgttgac tgacactact      3000
     acgcgtctgg tgatccgtct cggcgtggcc tatggctccg atctggaaaa agtgcgtaaa      3060
     gtgttactga aggcggcgac tgagcaccca agggtgatgc acgaaccaat gccggaagtc      3120
     ttctttacgg catttggtgc cagcacgttg gatcatgagc tgcgtctgta tgtgcgtgaa      3180
     ctgcgtgacc gtagtcgtac tgtcgatgag ctgaaccgta ctatcgatca gctgtgccgt      3240
     gaaaacgaca tcaacattgc ctttaaccag cttgaagtgc atctgcacaa cgagaagggc      3300
     gatgaggtga cggaagtaaa acgcgactac aaaggcgatg acccgacgcc agcggtaggg      3360
     taa                                                                    3363
//

If you have problems or comments...

PBIL Back to PBIL home page