(data stored in ACNUC7421 zone)

EMBL: CP001509.N

CP001509.N           Location/Qualifiers
FT   CDS_pept        complement(759487..759786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="N"
FT                   /locus_tag="ECD_10020"
FT                   /product="putative regulatory protein N (early gene
FT                   regulator)"
FT                   /note="similar to lambdap49; distantly related"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10020"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42602"
FT                   /protein_id="ACT42602.1"
FT                   /translation="MVTIVWKESKGTAKSRYKARRAELIAERRSNEALARKIALKLSGC
FT                   VRADKAASLGSLRCKKAEEVERKQNRIYYSKPRSEMGVTCVGRQKIKLGSKPLI"
     atggtaacca ttgtctggaa agaatccaaa ggtacggcaa aaagccgcta caaagctcgc        60
     agagcagaac ttattgccga gcgacgcagt aatgaagcac tggcgcgaaa aattgcgcta       120
     aagctctctg gttgcgtcag agcagataaa gcagcatcac tcggaagcct tcgctgcaag       180
     aaggcagaag aagtcgagcg taaacagaac cgtatttact acagcaagcc acgcagtgaa       240
     atgggtgtga cttgtgttgg tcgccagaaa attaaattag gcagcaaacc acttatttga       300
//

If you have problems or comments...

PBIL Back to PBIL home page