(data stored in ACNUC7421 zone)

EMBL: CP001509.NADA

CP001509.NADA        Location/Qualifiers
FT   CDS_pept        740493..741536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadA"
FT                   /locus_tag="ECD_00703"
FT                   /product="quinolinate synthase, subunit A"
FT                   /note="similar to b0750"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00703"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42578"
FT                   /protein_id="ACT42578.1"
FT                   /translation="MSVMFDPDTAIYPFPPKPTPLSIDEKAYYREKIKRLLKERNAVMV
FT                   AHYYTDPEIQQLAEETGGCISDSLEMARFGAKHPASTLLVAGVRFMGETAKILSPEKTI
FT                   LMPTLQAECSLDLGCPVEEFNAFCDAHPDRTVVVYANTSAAVKARADWVVTSSIAVELI
FT                   DHLDSLGEKIIWAPDKHLGRYVQKQTGGDILCWQGACIVHDEFKTQALTRLQEEYPDAA
FT                   ILVHPESPQAIVDMADAVGSTSQLIAAAKTLPHQRLIVATDRGIFYKMQQAVPDKELLE
FT                   APTAGEGATCRSCAHCPWMAMNGLQAIAEALEQEGSNHEVHVDERLRERALVPLNRMLD
FT                   FAATLRG"
     atgagcgtaa tgtttgatcc agacacggcg atttatcctt tccccccgaa gccgacgccg        60
     ttaagcattg atgaaaaagc gtattaccgc gagaagataa aacgtctgct aaaagaacgt       120
     aatgcggtga tggttgccca ctactatacc gatcccgaaa ttcaacaact ggcagaagaa       180
     accggtggct gtatttctga ttctctggaa atggcgcgct tcggtgcaaa gcatcccgct       240
     tctactttgt tagtcgctgg ggtgagattt atgggagaaa ccgccaaaat tctcagtccg       300
     gaaaaaacaa ttctgatgcc gacacttcag gctgaatgtt cactggatct cggctgccct       360
     gttgaagaat ttaacgcatt ttgcgatgcc catcccgatc gtactgtcgt cgtctacgcc       420
     aacacttctg ctgcggtaaa agcgcgcgca gattgggtgg taacttcaag cattgccgtc       480
     gaacttattg atcatcttga tagtttgggt gaaaaaatca tctgggcacc cgacaaacat       540
     ctggggcgtt acgtgcaaaa acagacgggt ggagacattc tatgctggca gggtgcctgt       600
     attgtgcatg atgaatttaa gactcaggcg ttaacccgct tgcaagaaga atacccggat       660
     gctgccatac tggtgcatcc agaatcacca caagctattg tcgatatggc ggatgcggtc       720
     ggttccacca gtcaactgat cgctgctgcg aaaacattgc cacatcagag gcttattgtg       780
     gcaaccgatc ggggtatttt ctacaaaatg cagcaggcgg tgccagataa agagttactg       840
     gaagcaccaa ccgcaggtga gggtgcaacc tgccgcagct gcgcgcattg tccgtggatg       900
     gccatgaatg gccttcaggc catcgcagag gcattagaac aggaaggaag caatcacgag       960
     gttcatgttg atgaaaggct gcgagagagg gcgctggtgc cgctcaatcg tatgctggat      1020
     tttgcggcta cactacgtgg ataa                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page