(data stored in ACNUC7421 zone)

EMBL: CP001509.NAGE

CP001509.NAGE        Location/Qualifiers
FT   CDS_pept        663818..665764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagE"
FT                   /locus_tag="ECD_00636"
FT                   /product="N-acetyl glucosamine specific PTS enzyme IIC,
FT                   IIB, and IIA components"
FT                   /EC_number="2.7.1.191"
FT                   /note="similar to b0679"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00636"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42512"
FT                   /protein_id="ACT42512.1"
FT                   /translation="MNILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNVAFIAQAG
FT                   GAIFDNLALIFAIGVASSWSKDSAGAAALAGAVGYFVLTKAMVTINPEINMGVLAGIIT
FT                   GLVGGAAYNRWSDIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHAIHAGG
FT                   EWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTVFHGDINRFYAG
FT                   DGTAGMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVAVTAFLTGVTEPLE
FT                   FLFMFLAPLLYLLHALLTGISLFVATLLGIHAGFSFSAGAIDYALMYNLPAASQNVWML
FT                   LVMGVVFFAIYFVVFSLVIRMFNLKTPGREDKEDEIVTEEANSNTEEGLTQLATNYIAA
FT                   VGGTDNLKAIDACITRLRLTVVDSARVNDAMCKRLGASGVVKLNKQTIQVIVGAKAESI
FT                   GDAMKKVVARGPVAAASAEATPATAAPVAKPQAVPNAVSIAELVSPITGDVVALDQVPD
FT                   EAFASKAVGDGVAVKPTDKIVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVA
FT                   LEGKGFKRLVEEGAQVSAGQPILEMDLDYLNANARSMISPVVCSNIDDFSGLIIKAQGH
FT                   VVAGQTPLYEIKK"
     atgaatattt taggtttttt ccagcgactc ggtagggcgt tacagctccc tatcgcggtg        60
     ctgccggtgg cggcgctgtt gctgcgattc ggtcagccag atttacttaa cgttgcgttt       120
     attgcccagg cgggcggtgc gatttttgat aacctcgcat taatcttcgc catcggtgtg       180
     gcatccagct ggtcgaaaga cagcgcaggt gcggcggcgc tggcgggtgc ggtaggttac       240
     tttgtgttaa ccaaagcgat ggtgaccatc aacccagaaa ttaacatggg tgtactggcg       300
     ggtatcatta ccggtctggt tggtggcgca gcctataacc gttggtccga tattaaactg       360
     cctgacttcc tgagcttctt cggcggcaaa cgctttgtgc cgattgccac cggcttcttc       420
     tgcctggtgc tggcggccat ttttggttac gtctggccgc cggtacagca cgctatccat       480
     gcaggcggcg agtggatcgt ttctgcgggc gcgctgggtt ccggtatctt tggtttcatc       540
     aaccgtctgc tgatcccaac cggtctgcat caggtgctga acaccatcgc ctggttccag       600
     attggtgaat tcaccaacgc ggcgggtacg gttttccacg gcgacatcaa ccgtttctac       660
     gctggtgacg gcaccgcggg gatgttcatg tccggcttct tcccgatcat gatgttcggt       720
     ctgccgggtg cggcgctggc gatgtacttc gcagcaccga aagagcgtcg tccgatggtt       780
     ggcgggatgc tgctttctgt tgctgttact gcgttcctga ccggtgtgac tgagccgctg       840
     gaattcctgt tcatgttcct tgcgccgctg ctgtacctcc tgcacgcact gctgaccggt       900
     atcagcctgt ttgtggcaac gctgctgggt atccacgcgg gcttctcctt ctctgcgggg       960
     gctatcgact acgcgttgat gtataacctg ccggccgcca gccagaacgt ctggatgctg      1020
     ctggttatgg gtgttgtctt cttcgctatc tacttcgtgg tgttcagttt ggttatccgt      1080
     atgttcaacc tgaaaacgcc gggccgtgaa gataaagaag acgagatcgt tactgaagaa      1140
     gccaacagca acacagaaga aggtctgact caactggcga ccaactatat tgctgcggtg      1200
     ggcggtactg acaacctgaa agcaattgac gcctgtatta ctcgtctgcg cctgaccgtg      1260
     gttgactcag ctcgcgtcaa cgatgcgatg tgtaaacgtc tgggtgcttc tggggtagtg      1320
     aaactgaaca aacagactat tcaggtgatt gttggcgcga aagcggaatc cattggcgat      1380
     gcaatgaaga aagttgttgc ccgtggtccg gtagccgctg cgtcagctga agcaactccg      1440
     gcaactgccg ctcctgtagc aaaaccgcag gctgtaccaa acgcggtgtc tatcgcggag      1500
     ctggtatcgc cgattaccgg tgatgttgtg gcactggatc aggttcctga cgaagcattc      1560
     gccagcaaag cggtgggtga cggtgtggcg gtgaaaccga cagataaaat cgtcgtatca      1620
     ccagccgcag ggacaatcgt gaaaatcttc aacaccaacc acgcgttctg cctggaaacc      1680
     gaaaaaggcg cggagatcgt cgtccatatg ggtatcgaca ccgtagcgct ggaaggtaaa      1740
     ggctttaaac gtctggtgga agagggggcg caggtaagcg cagggcaacc gattctggaa      1800
     atggatctgg attacctgaa cgctaacgcc cgctcgatga ttagcccggt ggtttgcagc      1860
     aatatcgacg atttcagtgg cttgatcatt aaagctcagg gccatgttgt ggcgggtcaa      1920
     acaccgctgt atgaaatcaa aaagtaa                                          1947
//

If you have problems or comments...

PBIL Back to PBIL home page