(data stored in ACNUC7421 zone)

EMBL: CP001509.NOHD

CP001509.NOHD        Location/Qualifiers
FT   CDS_pept        548011..548586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nohD"
FT                   /locus_tag="ECD_00511"
FT                   /product="DLP12 prophage; DNA packaging protein"
FT                   /note="similar to b0560"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00511"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42408"
FT                   /protein_id="ACT42408.1"
FT                   /translation="MEVNKKQLADIFGASIRTIQNWQEQGMPVLRGGGKGNEVLYDSAA
FT                   VIRWYAERDAEIENEKLRREVEELRQASETDLQPGTIEYERHRLTRAQADAQELKNARD
FT                   SAEVVETAFCTFVLSRIAGEIASILDGIPLSVQRRFPELENRHVDFLKRDIIKAMNKAA
FT                   ALDELIPEHGTGRRAGGLGAVRQPAGEP"
     atggaagtca acaaaaagca gctggctgac attttcggtg cgagtatccg taccattcag        60
     aactggcagg aacagggaat gcccgttctg cgaggcggtg gcaagggtaa tgaggtgctt       120
     tatgactctg ccgccgttat aagatggtat gccgaaaggg atgctgaaat tgagaacgaa       180
     aagctgcgcc gggaagttga agaactgcgg caggccagcg agacagatct ccagccaggg       240
     actattgagt acgaacgcca tcgacttacg cgtgcgcagg ccgacgcaca ggagctgaaa       300
     aatgccagag actccgctga agtggtggaa accgcattct gtactttcgt gctgtcgcgg       360
     atcgcaggtg aaattgccag tattctcgac gggatccccc tgtcggtgca gcggcgtttt       420
     ccggaactgg aaaaccgaca tgttgatttc ctgaaacggg atatcatcaa agccatgaac       480
     aaagcagccg cgctggatga actgataccc gaacacggca ctggtcggcg tgcaggtgga       540
     ctcggagcag ttcggcagcc agcaggtgag ccgtaa                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page