(data stored in ACNUC7421 zone)

EMBL: CP001509.O

CP001509.O           Location/Qualifiers
FT   CDS_pept        761465..762364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="O"
FT                   /locus_tag="ECD_10024"
FT                   /product="DNA replication protein"
FT                   /note="similar to lambdap89"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10024"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42606"
FT                   /protein_id="ACT42606.1"
FT                   /translation="MTNTAKILNFGRGNFAGQERNVADLDDGYARLSNMLLEAYSGADL
FT                   TKRQFKVLLAILRKTYGWNKPMDRITDSQLSEITKLPVKRCNEAKLELVRMNIIKQQGG
FT                   MFGPNKNISEWCIPQNEGKSPKTRDKTSLKLGDCYPSKQGDTKDTITKEKRKDYSSENS
FT                   GESSDQPENDLSVVKPDAAIQSGSKWGTAEDLTAAEWMFDMVKTIAPSARKPNFAGWAN
FT                   DIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVTA
FT                   SKPKLDLTNTDWIYGVDL"
     atgacaaata cagcaaaaat actcaacttc ggcagaggta actttgccgg acaggagcgt        60
     aatgtggcag atctcgatga tggttacgcc agactatcaa atatgctgct tgaggcttat       120
     tcgggcgcag atctgaccaa gcgacagttt aaagtgctgc ttgccattct gcgtaaaacc       180
     tatgggtgga ataaaccaat ggacagaatc accgattctc aacttagcga gattacaaag       240
     ttacctgtca aacggtgcaa tgaagccaag ttagaactcg tcagaatgaa tattatcaag       300
     cagcaaggcg gcatgtttgg accaaataaa aacatctcag aatggtgtat ccctcaaaac       360
     gagggaaaat cccctaaaac gagggataaa acatccctca aattggggga ttgctatccc       420
     tcaaaacagg gggacacaaa agacactatt acaaaagaaa aaagaaaaga ttattcgtca       480
     gagaattctg gcgaatcctc tgaccagcca gaaaacgacc tttctgtggt gaaaccggat       540
     gctgcaattc agagcggcag caagtggggg acagcagaag acctgaccgc cgcagagtgg       600
     atgtttgaca tggtgaagac tatcgcacca tcagccagaa aaccgaattt tgctgggtgg       660
     gctaacgata tccgcctgat gcgtgaacgt gacggacgta accaccgcga catgtgtgtg       720
     ctgttccgct gggcatgcca ggacaacttc tggtccggta acgtgctgag cccggccaaa       780
     ctccgcgata agtggaccca actcgaaatc aaccgtaaca agcaacaggc aggcgtgaca       840
     gccagcaaac caaaactcga cctgacaaac acagactgga tttacggggt ggatctatga       900
//

If you have problems or comments...

PBIL Back to PBIL home page