(data stored in ACNUC7421 zone)

EMBL: CP001509.P

CP001509.P           Location/Qualifiers
FT   CDS_pept        762361..763062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="P"
FT                   /locus_tag="ECD_10025"
FT                   /product="DNA replication protein"
FT                   /note="similar to lambdap61"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_10025"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42607"
FT                   /protein_id="ACT42607.1"
FT                   /translation="MKNIAAQMVNFDREQMRRIANNMPEQYDEKPQVQQVAQIINGVFS
FT                   QLLATFPASLANRDQNEVNEIRRQWVLAFRENGITTMEQVNAGMRVARRQNRPFLPSPG
FT                   QFVAWCREEASVTAGLPNVSELVDMVYEYCRKRGLYPDAESYPWKSNAHYWLVTNLYQN
FT                   MRANALTDAELRRKAADELVHMTARINRGEAIPEPVKQLPVMGGRPLNRAQALAKIAEI
FT                   KAKFGLKGASV"
     atgaaaaaca tcgccgcaca gatggttaac tttgaccgtg agcagatgcg tcggatcgcc        60
     aacaacatgc cggaacagta cgacgaaaag ccgcaggtac agcaggtagc gcagatcatc       120
     aacggtgtgt tcagccagtt actggcaact ttcccggcga gcctggctaa ccgtgaccag       180
     aacgaagtga acgaaatccg tcgccagtgg gttctggctt ttcgggaaaa cgggatcacc       240
     acgatggaac aggttaacgc aggaatgcgc gtagcccgtc ggcagaatcg accatttctg       300
     ccatcacccg ggcagtttgt tgcatggtgc cgggaagaag catccgttac cgccggactg       360
     ccaaacgtca gcgagctggt tgatatggtt tacgagtatt gccggaagcg aggcctgtat       420
     ccggatgcgg agtcttatcc gtggaaatca aacgcgcact actggctggt taccaacctg       480
     tatcagaaca tgcgggccaa tgcgcttact gatgcggaat tacgccgtaa ggccgcagat       540
     gagcttgtcc atatgactgc gagaattaac cgtggtgagg cgatccctga accagtaaaa       600
     caacttcctg tcatgggcgg tagacctcta aatcgtgcac aggctctggc gaagatcgca       660
     gaaatcaaag ctaagttcgg actgaaagga gcaagtgtat ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page