(data stored in ACNUC7421 zone)

EMBL: CP001509.PAOA

CP001509.PAOA        Location/Qualifiers
FT   CDS_pept        complement(272071..272760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paoA"
FT                   /locus_tag="ECD_00245"
FT                   /product="PaoABC aldehyde oxidoreductase, 2Fe-2S subunit"
FT                   /note="similar to b0286"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00245"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42144"
FT                   /protein_id="ACT42144.1"
FT                   /translation="MSNQGEYPEDNRVGKHEPHDFSLTRRDLIKVSAATAATAVVYPHS
FT                   TLAASVPAATPAPEIMPLTLKVNGKTEQLEVDTRTTLLDALRENLHLIGTKKGCDHGQC
FT                   GACTVLVNGRRLNACLTLAVMHQGAEITTIEGLGSPDNLHPMQAAFIKHDGFQCGYCTS
FT                   GQICSSVAVLKEIQDGIPSHVTVDLVSAPETTADEIRERMSGNICRCGAYANILAAIED
FT                   AAGEIKS"
     atgagcaacc aaggcgaata ccccgaagat aatcgggttg ggaagcacga gccgcacgat        60
     tttagtttga cccgtcgcga tctgattaaa gtgagcgccg caacggcggc gaccgccgtg       120
     gtttatcctc attctacgct tgcggcaagc gttccggcag ctacacccgc gccagagata       180
     atgcccctga cacttaaggt gaacggcaaa acggagcagc ttgaggtgga tacccgaacc       240
     acgctactgg acgctttgcg tgaaaatctg catttgatcg gtaccaagaa aggttgcgat       300
     cacggacagt gcggagcctg taccgtgctg gtcaatggtc gcaggcttaa tgcctgcctg       360
     acgcttgcag tcatgcatca gggggccgag atcaccacca ttgaaggcct gggttcacca       420
     gataatcttc accccatgca ggcggccttt atcaagcatg atggcttcca gtgcggctac       480
     tgcacctccg ggcaaatttg ctcatcagta gcggtgctaa aagagattca ggatggcatt       540
     cccagtcacg tcacggtcga tttggtttcc gctccagaaa caactgccga tgagatccgt       600
     gaacgtatga gcggcaacat ctgtcgctgt ggtgcatacg ctaacatcct tgccgccatt       660
     gaagacgctg cgggggagat aaaatcatga                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page