(data stored in ACNUC7421 zone)

EMBL: CP001509.PAOB

CP001509.PAOB        Location/Qualifiers
FT   CDS_pept        complement(271118..272074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paoB"
FT                   /locus_tag="ECD_00244"
FT                   /product="PaoABC aldehyde oxidoreductase, FAD-containing
FT                   subunit"
FT                   /note="similar to b0285"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00244"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42143"
FT                   /protein_id="ACT42143.1"
FT                   /translation="MKAFTYERVNTPAEAALSAQRVPGAKFIAGGTNLLDLMKLEIETP
FT                   THLIDVNGLGLDKIEVTDAGGLRIGALVRNTDLAAHERVRRDYAVLSRALLAGASGQLR
FT                   NQATTAGNLLQRTRCPYFYDTNQPCNKRLPGSGCAALEGFSRQHAVVGVSEACIATHPS
FT                   DMAVAMRLLDAVVETITPEGKTRSITLADFYHPPGKTPHIETALLPGELIIAVTLPPPL
FT                   GGKHIYRKVRDRASYAFALVSVAAIIQPDGSGRVALGGVAHKPWRIEAADAQLSQGAQA
FT                   VYDALFASAHPTAENTFKLLLAKRTLASVLAEARAQA"
     atgaaggcgt ttacctatga acgagtgaac acccccgccg aggcggcact tagcgctcag        60
     cgcgtacccg gcgcaaaatt tatcgcgggc gggaccaatc tgctggacct gatgaagctg       120
     gaaattgaaa cgcccaccca ccttatcgat gtgaacgggc tcgggctcga taagattgaa       180
     gtgaccgacg cgggtgggct gcgcatcggc gcactggtac ggaacaccga cctggcggct       240
     cacgagcgcg tgcgtcgtga ttacgcggta ctctcccgcg ccctgctcgc tggcgcgtct       300
     ggtcagttac gtaatcaggc aaccaccgca ggtaatctgc tccagcgcac gcgctgcccc       360
     tatttttacg acaccaatca gccctgcaat aagcgcctgc ccgggagcgg ctgcgcggcg       420
     cttgaaggct ttagccgtca gcacgcggtg gtaggcgtaa gcgaagcctg cattgccacc       480
     catccgagcg atatggcggt cgcaatgcgg ttgctggatg cggtggtgga aaccatcacg       540
     ccggagggaa agactcgcag tatcacactg gctgattttt atcacccacc ggggaaaacg       600
     ccgcacattg aaaccgccct gcttcccggc gagcttatca ttgcggtgac gttacctccg       660
     ccgctcggcg gaaaacatat ctaccgtaag gtgcgcgatc gcgcctccta cgcctttgcc       720
     ctggtatcgg tcgcagcgat tattcagcct gacggcagcg ggcgcgtcgc gctgggtgga       780
     gtagcacata agccctggcg cattgaggct gcggatgctc agctatccca gggggcacag       840
     gccgtgtatg acgcgctgtt cgccagcgcc catcccaccg ctgaaaacac ctttaaactc       900
     ctgttggcga agcgaacgct tgcctccgta ctggctgaag cgagggcaca agcatga          957
//

If you have problems or comments...

PBIL Back to PBIL home page