(data stored in ACNUC7421 zone)

EMBL: CP001509.PAOC

CP001509.PAOC        Location/Qualifiers
FT   CDS_pept        complement(268923..271121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paoC"
FT                   /locus_tag="ECD_00243"
FT                   /product="PaoABC aldehyde oxidoreductase, Moco-containing
FT                   subunit"
FT                   /note="similar to b0284"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00243"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42142"
FT                   /protein_id="ACT42142.1"
FT                   /translation="MKFDKPAGENPIDQLKVVGRPYDRIDGPLKTTGTARYAYEWHEES
FT                   PNAAYGYIVGSAMAKGRLTALDTDAAQKAPGVLAVITASNAGALGKGDKNTARLLGGPT
FT                   IEHYHQAIALVVAETFEQARAAASLVQAHYRRNKGAYSLADEKQAVSQPPEDTPDKNVG
FT                   DFDGAFTSAAVKIDATYTTPDQSHMAMEPHASMAVWDGNKLTLWTSNQMIDWCRTDLAK
FT                   TLKVPVENVRIISPYIGGGFGGKLFLRSDALLAALAARAVKRPVKVMLPRPTIPNNTTH
FT                   RPATLQHLRIGADQSGKITAISHESWSGNLPGGTPETAVQQSELLYAGANRHTGLRLAT
FT                   LDLPEGNAMRAPGEAPGLMALEIAIDELAEKAGIDPVEFRILNDTQVDPADPTRRFSRR
FT                   QLIECLRTGADKFGWKQRNATPGQVRDGEWLVGHGVAAGFRNNLLEKSGARVHLEPNGT
FT                   VTVETDMTDIGTGSYTILAQTAAEMLGVPLEQVAVHLGDSSFPVSAGSGGQWGANTSTS
FT                   GVYAACVKLREMIASAVGFDPEQSQFADGKITNGTRSAMLHEATAGGRLIAEESIEFGT
FT                   LSKEYQQSTFAGHFVEVGVHSATGEVRVRRMLAVCAAGRILNPKTARSQVIGAMTMGMG
FT                   AALMEELAVDDRLGYFVNHDMAGYEVPVHADIPKQEVIFLDDTDPISSPMKAKGVGELG
FT                   LCGVSAAIANAVYNATGIRVRDYPITLDKLLDKLPDVV"
     atgaaatttg ataaacccgc aggggaaaac ccgatcgatc agctgaaggt tgtcggtcgt        60
     ccctatgacc gcatcgacgg accgctgaaa actaccggca cggcacgcta cgcctacgaa       120
     tggcatgaag aatcccccaa cgccgcctat ggctatatcg tcggttccgc catggccaaa       180
     ggacgcctca ccgcccttga tacggacgcc gcgcaaaaag cgccgggcgt actggctgtc       240
     attaccgcca gtaacgccgg ggcactcggc aaaggcgaca aaaacaccgc caggctgtta       300
     ggcggtccca ctattgagca ctatcatcag gccattgcgc tggtagtggc cgagaccttc       360
     gaacaggcgc gagcggcggc ctcgctggtg caggcgcact atcgccgtaa taaaggagct       420
     tactccctgg cggacgaaaa acaggccgtc agtcagccgc cggaagacac gcccgacaaa       480
     aacgtcggtg actttgacgg agctttcacc tccgctgcgg tgaagattga tgctacctac       540
     acgaccccgg accagagcca tatggcgatg gagccgcatg cctcgatggc cgtctgggat       600
     ggaaataagc ttactctctg gacctcaaat cagatgattg actggtgccg caccgatctg       660
     gcaaaaacgc taaaagtgcc cgtggagaat gtgcgtatta tctccccgta tatcggcgga       720
     gggtttggcg gcaagctgtt cctgagaagc gatgcgctgc tggcggccct cgccgcccga       780
     gcggtgaaac gtccggttaa agtgatgctc ccccgcccca ctattcccaa taacaccacg       840
     caccgccccg ccacccttca gcacctgcgt atcggtgccg accagagcgg gaaaatcaca       900
     gctatctcac atgaaagctg gtccggaaac ctgcccggcg gcacgccgga aacggcggta       960
     cagcaaagcg aattactcta cgccggggca aaccgtcata ccggcctgcg gctcgccacg      1020
     cttgatttgc cggaagggaa cgccatgcgt gcgcccggcg aagcccccgg tctgatggcg      1080
     ctcgaaatcg cgatcgacga actggcggaa aaagcgggca tcgatcccgt cgagtttcgc      1140
     atcctgaatg acactcaggt tgaccccgcc gacccgacgc gccgcttctc tcgccgtcag      1200
     cttatcgagt gcttgcgcac cggagcggat aaatttggct ggaagcagcg caacgccaca      1260
     cccggacagg tgcgcgacgg ggagtggcta gtcggccacg gcgtcgcggc gggctttcgc      1320
     aataatctgc tggaaaaatc gggggctcgg gttcacctcg aaccaaacgg caccgttacc      1380
     gtggaaacgg acatgaccga cattggcacc ggcagctaca ccattctggc ccagacggca      1440
     gcggaaatgc ttggcgtacc gctggagcag gttgcggttc acctcggcga ttccagtttc      1500
     ccggtttctg cgggttctgg tggacaatgg ggcgcgaata cctccacctc cggcgtttac      1560
     gccgcctgtg tgaagcttcg cgaaatgatt gcctcggcag tcgggtttga tcctgagcag      1620
     tcgcagtttg ccgacggcaa gattaccaac ggtacccgaa gcgccatgct acatgaggcc      1680
     accgcaggcg gcagactgat agcggaagag agcattgaat tcggaacact gagcaaggag      1740
     taccagcagt cgacctttgc cgggcatttt gtggaggtcg gcgtgcatag cgcgacggga      1800
     gaagttcggg tccggcgtat gctcgctgtg tgtgctgcag gacgcatcct gaatccgaaa      1860
     actgcacgca gccaggtcat tggcgcaatg actatgggca tgggcgcggc actgatggag      1920
     gagctggcgg tggatgaccg tttgggctac ttcgttaatc acgatatggc ggggtatgag      1980
     gtgccggttc atgcggatat cccaaaacag gaggtgattt tcctggatga taccgacccc      2040
     atctcctccc cgatgaaggc caaaggtgtc ggtgagctgg gcctgtgcgg cgtgagcgcg      2100
     gctatcgcca acgcggtgta taacgccacc ggtattcggg tacgggatta tcccatcact      2160
     ctggataagc tgctcgataa actgccggat gtggtttaa                             2199
//

If you have problems or comments...

PBIL Back to PBIL home page