(data stored in ACNUC7421 zone)

EMBL: CP001509.PE20

CP001509.PE20        Location/Qualifiers
FT   CDS_pept        complement(19658..20617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_00020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00020"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41922"
FT                   /protein_id="ACT41922.1"
FT                   /translation="MKWLLLITLSLYSFIVQSAPCALTNVGEQRGTYILKPLSMKGNLT
FT                   AEKIENTGNIIECTDLQETTNAIKVHFLTQNALKFKVGSRHYIINFPFEYDGKKIELPG
FT                   KSSYNLEEMLSAINFTIPYSIASVSDSSNTADIFPGTPFPLLFEIEVSSCTGNNTNCNS
FT                   VRFNYNLNTILQVNLMTCGFEDQSIDTGRFVLSRINNENYQFHHIRFDCIQGEQGELVF
FT                   EPSDVEYYFEPVTIQESGTSILKNELENSEDGAGQVGFQLSNDGTNEIQYGKSNYYSFQ
FT                   HPHEGSNQIPLFIRPRTYGNNVSSGQIMSRVKIVVMYN"
     atgaagtggc ttttattaat caccttgagt ctatattctt ttattgtgca aagtgctccc        60
     tgtgcattga ccaatgtcgg tgaacaacgt ggaacatata tactcaagcc actgagtatg       120
     aaaggtaatc tcaccgccga aaaaattgaa aacaccggaa atatcattga gtgtacagac       180
     ttgcaagaga caaccaacgc cattaaagtt cattttttaa cacagaacgc tttaaagttt       240
     aaagtcggaa gtcgtcatta tattattaat ttcccctttg aatatgacgg taaaaaaata       300
     gagcttccag ggaagtcatc ttataattta gaagaaatgc tatctgcgat aaatttcacc       360
     attccatatt ctatcgcatc tgtatcagat agttctaaca ccgcagacat ttttccagga       420
     actccttttc ctttgttgtt cgaaattgaa gtgagttcat gtacagggaa taatactaat       480
     tgtaatagcg tccgctttaa ttataattta aatactattt tacaggtaaa tttaatgacc       540
     tgtggttttg aagatcaatc catcgacact ggacgatttg tactgtctcg tatcaataat       600
     gaaaattatc agtttcatca tataagattt gactgcatcc agggcgagca aggtgaatta       660
     gtttttgaac ccagtgatgt tgaatattac tttgaaccag tgacgataca ggagtcagga       720
     accagcatat taaaaaatga gttagaaaac agtgaggacg gtgcgggtca agtaggcttt       780
     caactctcca atgatggtac gaatgaaatc cagtatggta aaagcaatta ctactctttt       840
     cagcatcccc atgaaggaag taatcagatt cctctattta ttcgcccgcg tacatatgga       900
     aataatgtct caagcgggca aataatgagc cgagtcaaaa tcgtggttat gtacaactaa       960
//

If you have problems or comments...

PBIL Back to PBIL home page