(data stored in ACNUC7421 zone)

EMBL: CP001509.PE21

CP001509.PE21        Location/Qualifiers
FT   CDS_pept        complement(20630..21775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_00021"
FT                   /product="putative usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00021"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41923"
FT                   /protein_id="ACT41923.1"
FT                   /translation="MAAWRYASQDYRTFSDHLYENDKHYHQSDYNDFYDIGRKNSLSAN
FT                   IMQPLSNNLGNVSLSALWRNYWGRSGNAKDYQFSYSNNWQHISYTFSASQSYDENNKEE
FT                   ERFNLFISIPFYWGDDIAKTRHQINLSNSTSFSKDGYSSNNTGITGIAGEHDQLNYGIY
FT                   VNQQQQNNDTSLGTNLSWRTPIAIIDGSYSHSKNAWQSGGSISSGLVVWSGGINITNQL
FT                   SDTFAILDAPGLEGAHINGQKYNRTNSKGQVVYDPIIPHRENHLVLDIANSESETELQG
FT                   NRQIIAPYRGAVSYVQFTTDQRKPWYIQALRPDGSPLTFGYDVLDLQENNIGVVGQGSR
FT                   LFIRVDEIPTGIKVALNDEQNLFCTITFQHVIDENKTYICQ"
     gtggccgcct ggcgttatgc ttcgcaggat tacaggacat tcagcgacca tctttacgaa        60
     aatgataaac actatcatca gagtgattat aatgattttt atgatattgg cagaaaaaat       120
     agcctttctg ccaatattat gcaaccttta tccaataatc tgggaaatgt atcattaagt       180
     gcgctttggc ggaattactg ggggcgaagt ggaaatgcta aagattacca attcagttac       240
     tccaataact ggcaacacat tagttatact ttctctgcca gccaatctta tgatgaaaat       300
     aataaagaag aggagcgttt taatctgttt atctccattc ctttctactg gggggatgat       360
     attgccaaaa cacgtcacca aattaactta tcgaattcga cctcattttc caaagatggc       420
     tattcctcca acaatactgg aattactggc atagccggtg aacatgatca gttaaattat       480
     ggtatatatg ttaatcagca acaacaaaat aatgatacct cgcttggtac gaatttaagc       540
     tggagaactc ccatcgccat aatagatggc agctatagtc attctaaaaa cgcctggcaa       600
     agtggtggaa gtattagtag tggattagtt gtctggtccg gtggtattaa tatcactaac       660
     cagttatccg atacatttgc aattctggat gcgcctggat tagaaggcgc gcatattaat       720
     ggacaaaaat acaaccgaac aaacagcaaa ggccaggttg tttacgaccc gattatacct       780
     catcgtgaaa accatctggt acttgatata gcaaacagtg aaagtgaaac agaattgcag       840
     ggcaatcgtc aaattattgc gccttaccgt ggagcagttt cttatgtgca gtttacaact       900
     gaccaacgta agccttggta tatacaggca ctgcgtcccg atggttcgcc attaaccttt       960
     ggctatgacg tactggatct ccaggaaaac aatattggag tcgttggcca gggtagtcgc      1020
     ctttttattc gcgtagatga aattccaact ggcataaaag ttgctctcaa tgatgaacag      1080
     aatttattct gtactattac ttttcaacac gttatcgatg aaaacaaaac atatatatgc      1140
     cagtaa                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page