(data stored in ACNUC7421 zone)

EMBL: CP001509.PE212

CP001509.PE212       Location/Qualifiers
FT   CDS_pept        242014..242385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_00212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00212"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42113"
FT                   /protein_id="ACT42113.1"
FT                   /translation="MESLPGVCILIWVIGCANAKVLKRCILPAPDGGVEKLSKPNLHGV
FT                   IKKVDLNTNEAEIKIKEGGAVSFIFNEETLYFTVFGGDFIMDYLKKVKNTEAWVWYKNC
FT                   DSKNKNVAVELLQIYELHQ"
     ttggagtcat taccgggagt gtgcattcta atttgggtta ttggatgtgc aaatgctaaa        60
     gttcttaaac gatgtatatt acccgctcct gatggtggcg tagaaaaact atcaaaaccc       120
     aacttacatg gagtaattaa aaaagttgat ttgaacacaa atgaagcgga aattaaaata       180
     aaagaggggg gggcagtgag ttttattttt aatgaggaaa cattgtattt tactgttttt       240
     ggtggggatt ttattatgga ttatttaaaa aaagtaaaaa atacggaagc atgggtatgg       300
     tataaaaatt gcgatagtaa aaataaaaat gtggcagttg aacttcttca aatctacgaa       360
     ttgcatcaat ga                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page