(data stored in ACNUC7421 zone)

EMBL: CP001509.PE22

CP001509.PE22        Location/Qualifiers
FT   CDS_pept        complement(22208..22912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_00022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00022"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41924"
FT                   /protein_id="ACT41924.1"
FT                   /translation="MPSRLIEKSAYCSTENMATNKFDVVFSYCGDNIKEFILLLPYNKS
FT                   LEMYELNDQKIQYLTAPNINIHKMSLSNITIEKSNLSYGYYFSCVLSNISCFESDLSNT
FT                   IFSNGEINNLFIKKSNIFGASFTNTRIKNLLCEDIMPGRWTTQLVNKHLGYRYTGVFKT
FT                   LASIDDKPSRFEILIPLVQTLVRDNVKLNNDVYKELKKFMHDYDKTSPEMRKYLQSINE
FT                   SMFLMKNIAHQN"
     gtgcccagtc ggttaataga aaaatcagct tactgctcaa ctgaaaatat ggccactaat        60
     aaatttgatg tcgtcttttc ttactgcgga gataatataa aggaatttat acttttatta       120
     ccctataata aatcactgga gatgtatgaa cttaacgatc aaaagatcca gtatttgact       180
     gcccctaata tcaatataca taaaatgtcg ctatcaaata taacaataga aaagagcaac       240
     ctttcatatg ggtattattt tagttgtgta ttatccaata tatcatgttt tgaaagcgac       300
     ttatcaaaca ccatcttttc aaatggagaa attaataatc tcttcattaa aaaaagcaac       360
     atatttggag catcattcac taataccaga ataaaaaatt tgctctgtga agatattatg       420
     cctggtcgat ggaccactca acttgtcaat aagcacttag gttacagata cacaggagta       480
     ttcaaaaccc tggcaagtat tgatgacaaa ccgtcccgtt tcgaaatttt gataccattg       540
     gtacaaactt tagttcgcga caatgtaaag ctaaataatg atgtgtataa agaactgaaa       600
     aagtttatgc acgattacga caaaacatcc ccggaaatga gaaaatacct tcagagcatc       660
     aacgagtcta tgttccttat gaaaaacata gctcatcaaa attaa                       705
//

If you have problems or comments...

PBIL Back to PBIL home page