(data stored in ACNUC7421 zone)

EMBL: CP001509.PE25

CP001509.PE25        Location/Qualifiers
FT   CDS_pept        complement(24054..24404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_00025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00025"
FT                   /db_xref="EnsemblGenomes-Tr:ACT41927"
FT                   /protein_id="ACT41927.1"
FT                   /translation="MTDGISTSPHCLYKSNIVDDVIINKTRQNELVKVFCEYKTEFLIL
FT                   FDDFFRSQDFPKPSPVLHHFFQYTHLRDAHFYRCKLIEHTVQFYFLNTKASHYLDWMFL
FT                   MTEQANVFLKRW"
     atgacagatg gtatctcaac ttcgccacat tgtctttata aatcaaatat agtagatgat        60
     gtaataataa ataaaacaag acaaaatgag ttagtaaaag tgttttgcga gtataaaaca       120
     gagttcttaa ttttgtttga tgactttttc agaagccagg attttcctaa accatctcca       180
     gtcctccatc atttttttca atatactcat ctgagagatg cacattttta tagatgtaaa       240
     ctcatagaac atacagttca attttatttt ttaaacacaa aggcatcaca ttacttagat       300
     tggatgtttt tgatgacaga acaagcgaat gtctttctga agagatggta a                351
//

If you have problems or comments...

PBIL Back to PBIL home page