(data stored in ACNUC7421 zone)

EMBL: CP001509.PE263

CP001509.PE263       Location/Qualifiers
FT   CDS_pept        complement(294036..294248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_00265"
FT                   /product="hypothetical protein"
FT                   /note="similar to b0309; deleted entry from K-12 MG1655"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00265"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42164"
FT                   /protein_id="ACT42164.1"
FT                   /translation="MDACLFHCKYPGIGNTRIFTEEQHNHDGTGLSQVVLNAIFNLVCL
FT                   LQVYVQTSYLSQQSSIIRYTAFTGP"
     atggatgcct gtctttttca ctgtaaatat cctggcattg gtaataccag gatatttaca        60
     gaagagcagc ataaccatga cggaacgggg ttaagtcagg ttgtcctaaa cgctattttc       120
     aacctcgtat gccttcttca ggtttatgtc cagacttcat atctctctca acaatcctca       180
     ataatcagat acaccgcttt caccgggcca tga                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page