(data stored in ACNUC7421 zone)

EMBL: CP001509.PE374

CP001509.PE374       Location/Qualifiers
FT   CDS_pept        412484..413419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_00376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00376"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42275"
FT                   /protein_id="ACT42275.1"
FT                   /translation="MLTKRILFSVMLIVSPSVVASEKAHELYDSIYGGKPAPDVINTLH
FT                   KMAESGDIDAQSLLGWEYYQPRYDTKPDVQEAIKWFELAAKQGDREAPLALGGIYYDGE
FT                   QVRVDYAKAYALFNQAAQHGVNLAWSRLGIMYANGQYVEVDCKKAKEYLDKGVHIYGGP
FT                   EDFLATCRKDMIDRKTVDDTLPVITVTRSGMRDNFLDKGFSCMDSLFATTNKLGEVANL
FT                   RVTFSIRRPSGKEINQTVGFAPFGLNRLNISFTDYLFGSFTSNSSLILYKPEFERKSCA
FT                   TVRTTIVAATATINGKDVELLKAGAIEQKW"
     atgttaacta aaagaatatt attttctgta atgctgatag tttcaccaag cgtggtggcc        60
     agcgagaaag cgcatgaatt gtatgacagc atatacggtg gtaaacctgc tcccgatgtt       120
     ataaatacac tgcataaaat ggctgaatcg ggagatatcg acgcgcagag cctgttaggc       180
     tgggaatatt atcagcctcg ttatgatacc aaacctgatg ttcaggaagc gattaaatgg       240
     ttcgagttag cggctaaaca aggtgacaga gaagctccgt tagcgctggg gggtatctac       300
     tacgacggtg agcaggtgcg ggtggattat gccaaagcgt atgcactatt taatcaggcc       360
     gcgcagcacg gtgtgaattt agcatggtcc aggttgggca ttatgtacgc caatggtcag       420
     tatgttgagg tagattgtaa gaaagcgaag gaatatcttg ataaaggtgt ccacatttat       480
     ggtggcccgg aagactttct ggctacttgt cgaaaagaca tgattgacag aaaaacggtt       540
     gacgatacgt tacccgtgat tacggttacc cgttctggga tgcgagataa ttttttagat       600
     aaaggttttt cctgcatgga tagcctcttc gccaccacca ataaattagg cgaagtggcc       660
     aatcttcgcg tgacattcag cattcgtcgc ccatccggta aggagattaa ccaaacggtt       720
     ggcttcgcgc ctttcggttt aaaccggctg aatattagct ttactgatta cctatttggt       780
     tcatttacca gtaattcgtc tcttattctt tataaaccgg aatttgagcg aaaatcttgt       840
     gcaactgtaa ggaccacaat cgttgccgca acggcaacca ttaacggcaa ggatgtggag       900
     ttgctgaaag cgggggcaat tgaacaaaag tggtaa                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page