(data stored in ACNUC7421 zone)

EMBL: CP001509.PE376

CP001509.PE376       Location/Qualifiers
FT   CDS_pept        complement(414001..414378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECD_00378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00378"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42277"
FT                   /protein_id="ACT42277.1"
FT                   /translation="MIAVLCMRSTPYDFIQLIKEVIMPGKTATLPDVDKTLKNARVELK
FT                   TSPDAKNKLREAAQAVGVDLSAFILSAAMERAESVLDNQRRRELSNQSWELMNQLIAEP
FT                   AQPTLALKALMKRKNSDGRQA"
     ttgatagccg tattatgtat gagatcgact ccctacgatt tcattcagtt aatcaaagag        60
     gtcataatgc ctggaaaaac agccactcta cccgatgtcg ataaaacgct gaaaaatgcg       120
     cgggtcgaac tcaaaactag tcccgacgcc aaaaacaaac ttcgtgaagc tgcgcaagcc       180
     gttggggtag atttaagcgc ttttattttg agcgctgcta tggaacgcgc cgaaagtgtg       240
     cttgataacc aacgtcgccg tgagctttcg aatcaaagct gggaactgat gaaccaactc       300
     atcgctgaac ctgctcaacc gacgctcgcc ctcaaggcgt taatgaaaag gaaaaacagc       360
     gatggtcgac aagcatga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page